Noggin Mouse Recombinant

Lyophilized powder at room temperature

Noggin Mouse Recombinant produced in E.Coli is a non-glycosylated, disulfide-linked protein consisting of two 206 amino acid polypeptide chains, having a total molecular mass of approximately 46.4 kDa (each chain 23.2 kDa).
Amino Acid Sequence:MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGQRCGWIPIQYPIISECKCSC.
Physical Appearance and Stability: Lyophilized Mouse Noggin although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution Mouse Noggin should be stored at 4C between 2-7 days and for future use below -18C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Formulation and Purity: Lyophilized from a 0.2?m filtered solution in 30% acetonitrile, 0.1% TFA. Greater than 95.0% as determined by SDS-PAGE.
Solubility: It is recommended to be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 10mM HAc to a concentration of 0.1-1.0 mg/ml. Further dilutions should be made in appropriate buffered solutions.
Biological Activity: The ED50 as determined by inhibiting BMP-4-induced alkaline phosphatase production of murine ATDC5 cells is less than 2ng/ml, corresponding to a specific activity of > 5.0 x 105 IU/mg in the presence of 5ng/ml BMP-4.