Ciliary Neurotrophic Factor Rat Recombinant

Lyophilized powder at room temperature.

CNTF Recombinant Rat produced in E.Coli is a single, non-glycosylated polypeptide chain containing 200 amino acids and having a molecular mass of 22834 Dalton. The CNTF is purified by proprietary chromatographic techniques.
Amino Acid Sequence:AFAEQTPLTL HRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM.
Physical Appearance and Stability: Lyophilized CNTF although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution CNTF should be stored at 4C between 2-7 days and for future use below -18C.Please prevent freeze-thaw cycles.
Formulation and Purity: Lyophilized from a concentrated (1mg/ml) solution in water containing 0.025% NaHCO3. Greater than 99.0% as determined by:(a) Analysis by Gel Filtration.(b) Analysis by SDS-PAGE.
Solubility: It is recommended to reconstitute the lyophilized CNTF in sterile water or 0.4% NaHCO3 adjusted to pH 8-9, not less than 100ug/ml, which can then be further diluted to other aqueous solutions, preferably in presence of carrier protein.
Biological Activity: Fully biologically active by its ability to phosphorylate STAT3 in several cells lines.