Vergleich

Glia Maturation Factor Beta Human Recombinant

ArtNr ANG-rAP-2679-2ug
Hersteller Angio-Proteomie
Menge 2 ug
Quantity options 1000 ug 10 ug 1 ea 2 ug
Kategorie
Typ Proteins Recombinant
Format Lyophilized
Specific against other
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Glia maturation factor beta, GMFB, GMF-B, GMF-beta, GMF.
Versandbedingung Raumtemperatur
Lieferbar
Shipping Temperature
Lyophilized powder at room temperature.
Usage statement
Usage Statement: Our products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Description
Glia Maturation Factor-Beta (GMF-Beta) Human Recombinant produced in E.Coli is a signle, non-glycosylated, polypeptide chain containing 141 amino acids and having a total molecular mass of 16.5 kDa. Glia Maturation Factor-Beta, GMF-Beta, Human Recombinant is purified by proprietary chromatographic techniques.
Amino Acid Sequence:SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQT AELTKVFEIRNTEDLTEEWLREKLGFFH.
Physical Appearance and Stability: Lyophilized GMF-B although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution GMF-beta should be stored at 4C between 2-7 days and for future use below -18C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Formulation and Purity: The GMF-beta protein was lyophilized after dialysis against 20mM PBS pH=7.4 and 130mM NaCl. Greater than 98.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Solubility: It is recommended to reconstitute the lyophilized GMFB in sterile 18MO-cm H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 2 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen