« Zurück
Startseite /
ABflo® 488 Rabbit anti-Human CD28 mAb

ABflo® 488 Rabbit anti-Human CD28 mAb

ArtNr	A23405-200T
Hersteller	Abclonal
Menge	200 T
Quantity options	100 T 100 ul 200 T 20 ul 500 T
Kategorie	Antibodies Flow Cytometry Primary Antibodies
Typ	Antibody Monoclonal
Applikationen	FC
Specific against	Human (Homo sapiens)
Isotype	IgG
Purity	Affinity purification
Sequence	MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
NCBI	CD28
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	Tp44
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Category	Monoclonal Antibodies
Manufacturer - Conjugate / Tag	ABflo® 488. Ex:491nm. Em:516nm.
Shipping Temperature	ice pack
Storage Conditions	Store at 2-8°C. Avoid freeze.\|Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Protein Weight	25kDa
Background	The protein encoded by this gene is essential for T-cell proliferation and survival, cytokine production, and T-helper type-2 development. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Manufacturer - Cross Reactivity	Human
Immunogen	Recombinant protein of human CD28 Full length(P10747).
Recommended Dilution	FC, 5 μl per 10^6 cells in 100 μl volume
Protein Size	25kDa
Route	Recombinant protein
Manufacturer - Research Area	Signal Transduction, Cell Biology Developmental Biology, Apoptosis, Immunology Inflammation, CDs, T Cell Receptor Signaling Pathway, Stem Cells, Hematopoietic Progenitors.
Antigen Seq	MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Manufacturer - Gene ID (Human)	940
Expected Protein Size	25kDa
Gene Symbol	CD28

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

A23405-200T-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200 T

lieferbar

Lieferung vsl. bis 13.11.2025