« Zurück
Startseite /
CNP Antibody - middle region

CNP Antibody - middle region

ArtNr	ARP33879_P050-25UL
Hersteller	AVIVA Systems Biology
Menge	25 ul
Kategorie	Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Targets for Rodent Neurosciences Antibodies Immunohistochemistry Western Blot Primary Antibodies Calcium Binding Protein Markers Microglia Markers
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB, IHC
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Dog (Canine, Canis lupus familiaris), Horse (Equine), Pig (Porcine, Sus scrofa domesticus)
Host	Rabbit
Sequence	LYSLGNGRWMLTLAKNMEVRAIFTGYYGKGKPVPTQGSRKGGALQSCTII
Citations	Voineskos,A.N., (2008) Psychiatr. Genet. 18 (3), 143-146
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	CNP1,HLD20
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Research Areas/Chromatin & Nuclear Signaling, Root Catalog/Research Areas/Disease Related, Root Catalog/Research Areas/Immunohistochemistry, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	47kDa
Species Tested	Human
Gene symbol	CNP
Gene Fullname	2', 3'-cyclic nucleotide 3' phosphodiesterase
Protein size	421
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	UBC; FAM96B; CIAO1; SOX2; MMS19; PEX14; MTNR1A; PRNP; PPP1CA; TUBA1A; PRKCD;
Description of target	CNP belongs to the cyclic nucleotide phosphodiesterase family. It interacts with tubulin and promotes microtubule assembly for process outgrowth in oligodendrocytes. reduced CNP expression in the schizophrenic brain is relevant to disease etiology and therefore provide support for the general hypothesis that altered oligodendrocyte function is an etiological factor in schizophrenia.
Nucleotide accession_num	NM_033133
Protein accession_num	NP_149124
Protein name	2', 3'-cyclic-nucleotide 3'-phosphodiesterase
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human CNP
Homology	Dog: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 79%; Rabbit: 93%; Rat: 86%
Concentration	0.5 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 25 ul

lieferbar

Lieferung vsl. bis 26.02.2026

Express-Lieferung: 8 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern