« Back
Home /
CNP Antibody - middle region

CNP Antibody - middle region

Item no.	ARP33879_P050-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Targets for Rodent Neurosciences Antibodies Immunohistochemistry Western Blot Primary Antibodies Calcium Binding Protein Markers Microglia Markers
Type	Antibody Polyclonal
Format	Liquid
Applications	WB, IHC
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Dog (Canine, Canis lupus familiaris), Horse (Equine), Pig (Porcine, Sus scrofa domesticus)
Host	Rabbit
Sequence	LYSLGNGRWMLTLAKNMEVRAIFTGYYGKGKPVPTQGSRKGGALQSCTII
Citations	Voineskos,A.N., (2008) Psychiatr. Genet. 18 (3), 143-146
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	CNP1,HLD20
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Research Areas/Chromatin & Nuclear Signaling, Root Catalog/Research Areas/Disease Related, Root Catalog/Research Areas/Immunohistochemistry, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	47kDa
Species Tested	Human
Gene symbol	CNP
Gene Fullname	2', 3'-cyclic nucleotide 3' phosphodiesterase
Protein size	421
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	UBC; FAM96B; CIAO1; SOX2; MMS19; PEX14; MTNR1A; PRNP; PPP1CA; TUBA1A; PRKCD;
Description of target	CNP belongs to the cyclic nucleotide phosphodiesterase family. It interacts with tubulin and promotes microtubule assembly for process outgrowth in oligodendrocytes. reduced CNP expression in the schizophrenic brain is relevant to disease etiology and therefore provide support for the general hypothesis that altered oligodendrocyte function is an etiological factor in schizophrenia.
Nucleotide accession_num	NM_033133
Protein accession_num	NP_149124
Protein name	2', 3'-cyclic-nucleotide 3'-phosphodiesterase
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human CNP
Homology	Dog: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 79%; Rabbit: 93%; Rat: 86%
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 2/26/2026

Express Delivery: Save 8 days

Compare

Add to wishlist

Get an offer