« Zurück
Startseite /
MKL1 Antibody - C-terminal region

MKL1 Antibody - C-terminal region

ArtNr	ARP37504_T100-25UL
Hersteller	AVIVA Systems Biology
Menge	25 ul
Kategorie	Oncology Antibodies Western Blot Primary Antibodies By Organ Heart & Blood Cancer
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Dog (Canine, Canis lupus familiaris), Horse (Equine), Pig (Porcine, Sus scrofa domesticus), Zebrafish (Danio rerio), Cow (Bos taurus)
Host	Rabbit
Sequence	QPLSQPGFPAPGPPAQMDLEHPPQPPFATPTSLLKKEPPGYEETVTQQPK
Citations	Interactome Mapping Provides a Network of Neurodegenerative Disease Proteins and Uncovers Widespread Protein Aggregation in Affected Brains. Cell Rep. 32, 108050 (2020). 32814053 Mechanism of irradiation-induced mammary cancer metastasis: A role for SAP-dependent Mkl1 signaling. Mol Oncol. 9, 1510-27 (2015). 25999144 Sasazuki,T., et al., (2002) J. Biol. Chem. 277 (32), 28853-28860
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	M,Bs,Mal,Mkl,AMKL,Bsac,MRTF,Mkl1,Mrtf-A
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Research Areas/Developmental Biology, Root Catalog/Research Areas/Signal Transduction, Root Catalog/Research Areas/Stem Cells, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Research Areas/Cell Differentiation, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal, Root Catalog/Research Areas/Cancer/Cancer Transcription Factor
Shipping Temperature	Wet Ice
Molecular Weight	106kDa
Species Tested	Mouse
Gene symbol	MKL1
Gene Fullname	MKL (megakaryoblastic leukemia)/myocardin-like 1
Protein size	964
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	Lhx2; SRF;
Description of target	MKL1 transduces cytoskeletal signals and induces smooth muscle cell differentiation from undifferentiated embryonic stem cells
Nucleotide accession_num	NM_153049
Protein accession_num	NP_694629
Protein name	MKL/myocardin-like protein 1
Clonality	Polyclonal
Purification	Protein A purified
Immunogen	The immunogen is a synthetic peptide corresponding to a region of Mouse
Homology	Cow: 86%; Dog: 86%; Horse: 86%; Human: 79%; Mouse: 100%; Pig: 86%; Rabbit: 86%; Rat: 100%; Zebrafish: 75%
Concentration	1.0 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 25 ul

lieferbar

Lieferung vsl. bis 30.10.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern