« Back
Home /
MKL1 Antibody - C-terminal region

MKL1 Antibody - C-terminal region

Item no.	ARP37504_T100-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Oncology Antibodies Western Blot Primary Antibodies By Organ Heart & Blood Cancer
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Dog (Canine, Canis lupus familiaris), Horse (Equine), Pig (Porcine, Sus scrofa domesticus), Zebrafish (Danio rerio), Cow (Bos taurus)
Host	Rabbit
Sequence	QPLSQPGFPAPGPPAQMDLEHPPQPPFATPTSLLKKEPPGYEETVTQQPK
Citations	Interactome Mapping Provides a Network of Neurodegenerative Disease Proteins and Uncovers Widespread Protein Aggregation in Affected Brains. Cell Rep. 32, 108050 (2020). 32814053 Mechanism of irradiation-induced mammary cancer metastasis: A role for SAP-dependent Mkl1 signaling. Mol Oncol. 9, 1510-27 (2015). 25999144 Sasazuki,T., et al., (2002) J. Biol. Chem. 277 (32), 28853-28860
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	M,Bs,Mal,Mkl,AMKL,Bsac,MRTF,Mkl1,Mrtf-A
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Research Areas/Developmental Biology, Root Catalog/Research Areas/Signal Transduction, Root Catalog/Research Areas/Stem Cells, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Research Areas/Cell Differentiation, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal, Root Catalog/Research Areas/Cancer/Cancer Transcription Factor
Shipping Temperature	Wet Ice
Molecular Weight	106kDa
Species Tested	Mouse
Gene symbol	MKL1
Gene Fullname	MKL (megakaryoblastic leukemia)/myocardin-like 1
Protein size	964
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	Lhx2; SRF;
Description of target	MKL1 transduces cytoskeletal signals and induces smooth muscle cell differentiation from undifferentiated embryonic stem cells
Nucleotide accession_num	NM_153049
Protein accession_num	NP_694629
Protein name	MKL/myocardin-like protein 1
Clonality	Polyclonal
Purification	Protein A purified
Immunogen	The immunogen is a synthetic peptide corresponding to a region of Mouse
Homology	Cow: 86%; Dog: 86%; Horse: 86%; Human: 79%; Mouse: 100%; Pig: 86%; Rabbit: 86%; Rat: 100%; Zebrafish: 75%
Concentration	1.0 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer