« Zurück
Startseite /
PPARD Antibody - N-terminal region

PPARD Antibody - N-terminal region

ArtNr	ARP37889_T100-25UL
Hersteller	AVIVA Systems Biology
Menge	25 ul
Kategorie	Metabolism Diabetes Glucose Homeostasis Cholesterol & Lipid Metabolism Regulation of Appetite Antibodies Western Blot Primary Antibodies
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Cow (Bos taurus)
Host	Rabbit
Sequence	FGRMPEAEKRKLVAGLTASEGCQHNPQLADLKAFSKHIYNAYLKNFNMTK
Citations	Ares-Carrasco, S. et al. Proteome changes in the myocardium of experimental chronic diabetes and hypertension: role of PPARa in the associated hypertrophy. J. Proteomics 75, 1816-29 (2012). 22234359 Failure to up-regulate transcription of genes necessary for muscle adaptation underlies limb girdle muscular dystrophy 2A (calpainopathy). Hum. Mol. Genet. 25, 2194-2207 (2016). 27005420 Predictive Role of Biopsy Based Biomarkers for Radiotherapy Treatment in Rectal Cancer. J Pers Med. 10, NULL (2020). 33066317 Yang, L. et al. Biological function and prognostic significance of peroxisome proliferator-activated receptor d in rectal cancer. Clin. Cancer Res. 17, 3760-70 (2011). 21531809 Yang, L. et al. Knockdown of peroxisome proliferator-activated receptor-beta induces less differentiation and enhances cell-fibronectin adhesion of colon cancer cells. Oncogene 29, 516-26 (2010). 19935699 Nadra,K., et al., (2006) Mol. Cell. Biol. 26 (8), 3266-3281
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	P,NUC,Nr1,Ppa,NUC1,PPAR,NUC-1,Nr1c2,Pparb,PPAR[b],Pparb/d,PPAR-beta,PPARdelta,PPAR-delta
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Products/Polyclonal Antibodies/Growth Factors & Hormones, Root Catalog/Research Areas/GPCR, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Research Areas/Cell Differentiation, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	48kDa
Species Tested	Mouse
Gene symbol	PPARD
Gene Fullname	Peroxisome proliferator activator receptor delta
Protein size	440
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	Scand1; HDAC7; NCOR2; BCL6; HSP90AA1; Apc; Rxrg; Rxra; Dut; GADD45A;
Description of target	PPARdelta is pivotal to control the program for fatty acid oxidation in the skeletal muscle, thereby ameliorating obesity and insulin resistance through its activation in obese animals.
Nucleotide accession_num	NM_011145
Protein accession_num	NP_035275
Protein name	Peroxisome proliferator-activated receptor delta
Clonality	Polyclonal
Purification	Protein A purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of mouse PPARD
Homology	Cow: 85%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 93%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Concentration	1.0 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 25 ul

lieferbar

Lieferung vsl. bis 30.10.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern