« Back
Home /
PPARD Antibody - N-terminal region

PPARD Antibody - N-terminal region

Item no.	ARP37889_T100-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Metabolism Diabetes Glucose Homeostasis Cholesterol & Lipid Metabolism Regulation of Appetite Antibodies Western Blot Primary Antibodies
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Cow (Bos taurus)
Host	Rabbit
Sequence	FGRMPEAEKRKLVAGLTASEGCQHNPQLADLKAFSKHIYNAYLKNFNMTK
Citations	Ares-Carrasco, S. et al. Proteome changes in the myocardium of experimental chronic diabetes and hypertension: role of PPARa in the associated hypertrophy. J. Proteomics 75, 1816-29 (2012). 22234359 Failure to up-regulate transcription of genes necessary for muscle adaptation underlies limb girdle muscular dystrophy 2A (calpainopathy). Hum. Mol. Genet. 25, 2194-2207 (2016). 27005420 Predictive Role of Biopsy Based Biomarkers for Radiotherapy Treatment in Rectal Cancer. J Pers Med. 10, NULL (2020). 33066317 Yang, L. et al. Biological function and prognostic significance of peroxisome proliferator-activated receptor d in rectal cancer. Clin. Cancer Res. 17, 3760-70 (2011). 21531809 Yang, L. et al. Knockdown of peroxisome proliferator-activated receptor-beta induces less differentiation and enhances cell-fibronectin adhesion of colon cancer cells. Oncogene 29, 516-26 (2010). 19935699 Nadra,K., et al., (2006) Mol. Cell. Biol. 26 (8), 3266-3281
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	P,NUC,Nr1,Ppa,NUC1,PPAR,NUC-1,Nr1c2,Pparb,PPAR[b],Pparb/d,PPAR-beta,PPARdelta,PPAR-delta
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Products/Polyclonal Antibodies/Growth Factors & Hormones, Root Catalog/Research Areas/GPCR, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Research Areas/Cell Differentiation, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	48kDa
Species Tested	Mouse
Gene symbol	PPARD
Gene Fullname	Peroxisome proliferator activator receptor delta
Protein size	440
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	Scand1; HDAC7; NCOR2; BCL6; HSP90AA1; Apc; Rxrg; Rxra; Dut; GADD45A;
Description of target	PPARdelta is pivotal to control the program for fatty acid oxidation in the skeletal muscle, thereby ameliorating obesity and insulin resistance through its activation in obese animals.
Nucleotide accession_num	NM_011145
Protein accession_num	NP_035275
Protein name	Peroxisome proliferator-activated receptor delta
Clonality	Polyclonal
Purification	Protein A purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of mouse PPARD
Homology	Cow: 85%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 93%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Concentration	1.0 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer