FOXG1B Antibody - N-terminal region

ArtNr	ARP38595_T100-25UL
Hersteller	AVIVA Systems Biology
Menge	25 ul
Kategorie	Oncology Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Targets for Rodent Neurosciences Aging & Neurological Disorders Neural Epigenetics Antibodies Immunohistochemistry Western Blot Primary Antibodies By Organ Colorectal Cancer Neurodegeneration Markers
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB, IHC
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
Host	Rabbit
Sequence	MLDMGDRKEVKMIPKSSFSINSLVPEAVQNDNHHASHGHHNSHHPQHHHH
Citations	Tan,K., (2003) J. Biol. Chem. 278 (23), 20507-20513
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	BF1,BF2,QIN,FKH2,HBF2,HFK1,HFK2,HFK3,KHL2,FHKL3,FKHL1,FKHL2,FKHL3,FKHL4,HBF-1,HBF-2,HBF-3,FOXG1A,FOXG1B,FOXG1C,HBF-G2
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Neurobiology, Root Catalog/Products/Polyclonal Antibodies/Transcription Regulation, Root Catalog/Research Areas/Developmental Biology, Root Catalog/Research Areas/Immunohistochemistry, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	52kDa
Species Tested	Human
Gene symbol	FOXG1
Gene Fullname	Forkhead box G1
Protein size	489
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	APOE; TLE1; TRAF6; KDM5B; FOXH1; EEF1G; SMAD3; FOXO3; GDF9; SMAD1; SMAD2; HDAC1; SMAD4; TLE3; FOXO4; HES1; FOXO1;
Description of target	FOXG1B belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of FOXG1B has not yet been determined; however, it may play a role in the development of the brain and telencephalonThis gene belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the development of the brain and telencephalon.This gene belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the development of the brain and telencephalon.
Nucleotide accession_num	NM_005249
Protein accession_num	NP_005240
Protein name	Forkhead box protein G1
Clonality	Polyclonal
Purification	Protein A purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human FOXG1B
Homology	Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 93%
Concentration	1.0 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 25 ul

lieferbar

Lieferung vsl. bis 30.10.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern