« Zurück
Startseite /
Pura Antibody - C-terminal region

Pura Antibody - C-terminal region

ArtNr	ARP38689_P050-25UL
Hersteller	AVIVA Systems Biology
Menge	25 ul
Kategorie	Oncology Neuroscience Molecular Targets for Neuroscience Antibodies By Cell Type Blastoma Carcinoma Hematology Leukemia Lymphoma Myeloma Melanoma Sarcoma Western Blot Primary Antibodies By Organ Bladder Cancer Colorectal Cancer
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Sheep (Ovine, Ovis aries), Dog (Canine, Canis lupus familiaris), Zebrafish (Danio rerio), Yeast (Saccharomyces cerevisiae), Cow (Bos taurus)
Host	Rabbit
Sequence	KPTYRNSITVPYKVWAKFGHTFCKYSEEMKKIQEKQREKRAACEQLHQQQ
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	Pur,ssCR,CAGER,CAGER-1,ssCRE-BP,Pur-alpha,6330411E07R,6330411E07Rik
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Research Areas/DNA Damage & Repair, Root Catalog/Research Areas/DNA\/RNA\/Protein Interactions, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Research Areas/Cell Differentiation, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	35kDa
Species Tested	Mouse
Gene symbol	PURA
Gene Fullname	Purine rich element binding protein A
Protein size	321
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	Rara; Cdk5; Ywhae; Ccnb1; Hist1h1a; Ccnh; Cdk4; Cdk2; Cdk1; Ccne1; Ccnd1; Ccna2; Fmr1; E2f1;
Description of target	Pura is a probable transcription activator that specifically binds the purine-rich single strand of the PUR element located upstream of the c-Myc gene. Pura may play a role in the initiation of DNA replication and in recombination.
Nucleotide accession_num	NM_008989
Protein accession_num	NP_033015
Protein name	Transcriptional activator protein Pur-alpha
Clonality	Polyclonal
Purification	Affinity Purified
Homology	Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Yeast: 83%; Zebrafish: 93%
Concentration	0.5 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 25 ul

lieferbar

Lieferung vsl. bis 30.10.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern