« Back
Home /
Pura Antibody - C-terminal region

Pura Antibody - C-terminal region

Item no.	ARP38689_P050-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Oncology Neuroscience Molecular Targets for Neuroscience Antibodies By Cell Type Blastoma Carcinoma Hematology Leukemia Lymphoma Myeloma Melanoma Sarcoma Western Blot Primary Antibodies By Organ Bladder Cancer Colorectal Cancer
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Sheep (Ovine, Ovis aries), Dog (Canine, Canis lupus familiaris), Zebrafish (Danio rerio), Yeast (Saccharomyces cerevisiae), Cow (Bos taurus)
Host	Rabbit
Sequence	KPTYRNSITVPYKVWAKFGHTFCKYSEEMKKIQEKQREKRAACEQLHQQQ
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	Pur,ssCR,CAGER,CAGER-1,ssCRE-BP,Pur-alpha,6330411E07R,6330411E07Rik
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Research Areas/DNA Damage & Repair, Root Catalog/Research Areas/DNA\/RNA\/Protein Interactions, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Research Areas/Cell Differentiation, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	35kDa
Species Tested	Mouse
Gene symbol	PURA
Gene Fullname	Purine rich element binding protein A
Protein size	321
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	Rara; Cdk5; Ywhae; Ccnb1; Hist1h1a; Ccnh; Cdk4; Cdk2; Cdk1; Ccne1; Ccnd1; Ccna2; Fmr1; E2f1;
Description of target	Pura is a probable transcription activator that specifically binds the purine-rich single strand of the PUR element located upstream of the c-Myc gene. Pura may play a role in the initiation of DNA replication and in recombination.
Nucleotide accession_num	NM_008989
Protein accession_num	NP_033015
Protein name	Transcriptional activator protein Pur-alpha
Clonality	Polyclonal
Purification	Affinity Purified
Homology	Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Yeast: 83%; Zebrafish: 93%
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer