« Zurück
Startseite /
HBP1 Antibody - middle region

HBP1 Antibody - middle region

ArtNr	ARP38977_P050-25UL
Hersteller	AVIVA Systems Biology
Menge	25 ul
Kategorie	Oncology Neuroscience Molecular Targets for Neuroscience Aging & Neurological Disorders Neural Epigenetics Antibodies By Cell Type Blastoma Carcinoma Glioma Hematology Leukemia Lymphoma Myeloma Melanoma Sarcoma Cell Biology Cell Status Western Blot Senescence Primary Antibodies Astrocytoma By Organ Bladder Cancer Bone Cancer
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Zebrafish (Danio rerio), Cow (Bos taurus)
Host	Rabbit
Sequence	SVILGDRWKKMKNEERRMYTLEAKALAEEQKRLNPDCWKRKRTNSGSQQH
Citations	Li, H., Bian, C., Liao, L., Li, J. & Zhao, R. C. miR-17-5p promotes human breast cancer cell migration and invasion through suppression of HBP1. Breast Cancer Res. Treat. 126, 565-75 (2011). 20505989 Wang, W., Pan, K., Chen, Y., Huang, C. & Zhang, X. The acetylation of transcription factor HBP1 by p300/CBP enhances p16INK4A expression. Nucleic Acids Res. 40, 981-95 (2012). 21967847 Paulson,K.E., (2007) Cancer Res. 67 (13), 6136-6145
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	FLJ16340
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Research Areas/DNA\/RNA\/Protein Interactions, Root Catalog/Research Areas/Meiosis\/Mitosis\/Cell Cycle, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	58kDa
Species Tested	Human
Gene symbol	HBP1
Gene Fullname	HMG-box transcription factor 1
Protein size	514
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	FBXW11; UBC; TMEM37; SMAD1; ZNF212; KIAA1279; EWSR1; CD2AP; EP300; CREBBP; MYC; ANKRD2; SIN3A; SAP30; TCF4; HDAC1; RBL2; RB1;
Description of target	HBP1 is a transcriptional repressor that binds to the promoter region of target genes. This protein plays a role in the regulation of the cell cycle and of the Wnt pathway. It binds preferentially to the sequence 5'-TTCATTCATTCA-3'. Binding to the H1F0 promoter, HBP1 is enhanced by interaction with RB1. The protein also can disrupt the interaction between DNA and TCF4.
Nucleotide accession_num	NM_012257
Protein accession_num	NP_036389
Protein name	HMG box-containing protein 1
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human HBP1
Homology	Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Concentration	0.5 mg/ml
Sample Type Confirmation	HBP1 is supported by BioGPS gene expression data to be expressed in HeLa

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 25 ul

lieferbar

Lieferung vsl. bis 30.10.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern