« Back
Home /
HBP1 Antibody - middle region

HBP1 Antibody - middle region

Item no.	ARP38977_P050-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Oncology Neuroscience Molecular Targets for Neuroscience Aging & Neurological Disorders Neural Epigenetics Antibodies By Cell Type Blastoma Carcinoma Glioma Hematology Leukemia Lymphoma Myeloma Melanoma Sarcoma Cell Biology Cell Status Western Blot Senescence Primary Antibodies Astrocytoma By Organ Bladder Cancer Bone Cancer
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Zebrafish (Danio rerio), Cow (Bos taurus)
Host	Rabbit
Sequence	SVILGDRWKKMKNEERRMYTLEAKALAEEQKRLNPDCWKRKRTNSGSQQH
Citations	Li, H., Bian, C., Liao, L., Li, J. & Zhao, R. C. miR-17-5p promotes human breast cancer cell migration and invasion through suppression of HBP1. Breast Cancer Res. Treat. 126, 565-75 (2011). 20505989 Wang, W., Pan, K., Chen, Y., Huang, C. & Zhang, X. The acetylation of transcription factor HBP1 by p300/CBP enhances p16INK4A expression. Nucleic Acids Res. 40, 981-95 (2012). 21967847 Paulson,K.E., (2007) Cancer Res. 67 (13), 6136-6145
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	FLJ16340
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Research Areas/DNA\/RNA\/Protein Interactions, Root Catalog/Research Areas/Meiosis\/Mitosis\/Cell Cycle, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	58kDa
Species Tested	Human
Gene symbol	HBP1
Gene Fullname	HMG-box transcription factor 1
Protein size	514
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	FBXW11; UBC; TMEM37; SMAD1; ZNF212; KIAA1279; EWSR1; CD2AP; EP300; CREBBP; MYC; ANKRD2; SIN3A; SAP30; TCF4; HDAC1; RBL2; RB1;
Description of target	HBP1 is a transcriptional repressor that binds to the promoter region of target genes. This protein plays a role in the regulation of the cell cycle and of the Wnt pathway. It binds preferentially to the sequence 5'-TTCATTCATTCA-3'. Binding to the H1F0 promoter, HBP1 is enhanced by interaction with RB1. The protein also can disrupt the interaction between DNA and TCF4.
Nucleotide accession_num	NM_012257
Protein accession_num	NP_036389
Protein name	HMG box-containing protein 1
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human HBP1
Homology	Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Concentration	0.5 mg/ml
Sample Type Confirmation	HBP1 is supported by BioGPS gene expression data to be expressed in HeLa

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer