« Zurück
Startseite /
UNC45A Antibody - middle region

UNC45A Antibody - middle region

ArtNr	ARP56262_P050-25UL
Hersteller	AVIVA Systems Biology
Menge	25 ul
Kategorie	Oncology Food Safety Hormones Neuroscience Neural Signaling Antibodies By Cell Type Carcinoma Sarcoma Immunohistochemistry Western Blot Primary Antibodies By Organ Breast Cancer
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB, IHC
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Cow (Bos taurus)
Host	Rabbit
Sequence	REIASTLMESEMMEILSVLAKGDHSPVTRAAAACLDKAVEYGLIQPNQDG
Citations	Chadli,A., (2008) J. Biol. Chem. 283 (15), 9509-9512
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	SMAP1,SMAP-1,GCUNC45,UNC-45A,GC-UNC45,GCUNC-45,IRO039700
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Various, Root Catalog/Research Areas/Cell Differentiation, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	102kDa
Species Tested	Human
Gene symbol	UNC45A
Gene Fullname	Unc-45 homolog A (C. elegans)
Protein size	929
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	KRTAP10-3; MARCH10; MID2; HUWE1; MEOX2; MAX; CDC37; FAM83H; UBC; ACBD3; UGGT1; CSNK1E; CSNK1A1; gag-pol; SMAD9; HSP90AA1; ESR1; WDR5; USP14; USP1; UFD1L; UBE3A; RPA3; TWF1; PSMD13; CSE1L; TXNDC5; UCHL5; UBXN1; FBXO25; CLN3; USP19;
Description of target	UNC45A plays a role in cell proliferation and myoblast fusion, binds progesterone receptor (PGR; MIM 607311) and HSP90 (HSPCA; MIM 140571), and acts as a regulator of the progesterone receptor chaperoning pathway.
Nucleotide accession_num	NM_001039675
Protein accession_num	NP_001034764
Protein name	Protein unc-45 homolog A
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human UNC45A
Homology	Cow: 85%; Dog: 93%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 79%; Rat: 93%
Concentration	0.5 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 25 ul

lieferbar

Lieferung vsl. bis 30.10.2025

Express-Lieferung: 7 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern