« Back
Home /
UNC45A Antibody - middle region

UNC45A Antibody - middle region

Item no.	ARP56262_P050-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Oncology Food Safety Hormones Neuroscience Neural Signaling Antibodies By Cell Type Carcinoma Sarcoma Immunohistochemistry Western Blot Primary Antibodies By Organ Breast Cancer
Type	Antibody Polyclonal
Format	Liquid
Applications	WB, IHC
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Cow (Bos taurus)
Host	Rabbit
Sequence	REIASTLMESEMMEILSVLAKGDHSPVTRAAAACLDKAVEYGLIQPNQDG
Citations	Chadli,A., (2008) J. Biol. Chem. 283 (15), 9509-9512
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	SMAP1,SMAP-1,GCUNC45,UNC-45A,GC-UNC45,GCUNC-45,IRO039700
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Various, Root Catalog/Research Areas/Cell Differentiation, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	102kDa
Species Tested	Human
Gene symbol	UNC45A
Gene Fullname	Unc-45 homolog A (C. elegans)
Protein size	929
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	KRTAP10-3; MARCH10; MID2; HUWE1; MEOX2; MAX; CDC37; FAM83H; UBC; ACBD3; UGGT1; CSNK1E; CSNK1A1; gag-pol; SMAD9; HSP90AA1; ESR1; WDR5; USP14; USP1; UFD1L; UBE3A; RPA3; TWF1; PSMD13; CSE1L; TXNDC5; UCHL5; UBXN1; FBXO25; CLN3; USP19;
Description of target	UNC45A plays a role in cell proliferation and myoblast fusion, binds progesterone receptor (PGR; MIM 607311) and HSP90 (HSPCA; MIM 140571), and acts as a regulator of the progesterone receptor chaperoning pathway.
Nucleotide accession_num	NM_001039675
Protein accession_num	NP_001034764
Protein name	Protein unc-45 homolog A
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human UNC45A
Homology	Cow: 85%; Dog: 93%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 79%; Rat: 93%
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 7 days

Compare

Add to wishlist

Get an offer