« Zurück
Home /
Kv2.2 potassium channel

Kv2.2 potassium channel

Hersteller	Antibodies Incorporated
Kategorie	Antibodies Immunohistochemistry Immunocytochemistry Cardiovascular Research Ischemia & Reperfusion Injury Primary Antibodies Immunoblot
Typ	Antibody Monoclonal
Specific against	Mouse, Rat
Clon	N372C/51
Isotype	IgG1
Applikationen	IHC, ICC, IB
Menge	5 mL
Host	Mouse
ArtNr	73-358
eClass 6.1	32160702
eClass 9.0	42030590
Lieferbar
Applications info	Immunoblot (IB), Immunohistochemistry (IHC), Immunocytochemistry (ICC)
Category Name	Membrane Channels
ABID	RRID:AB_2315865
Channel Target	K+ Channels
Cross Reactivity	Cross-reacts with Kv2.2 short isoform Does not cross-react with Kv2.1
Description	Immunogen: Fusion protein amino acids 717-907 (cytoplasmic C-terminus) of rat Kv2.2 long isoform (also known as Potassium voltage-gated channel subfamily B member 2, Kcnb2 and CDRK, accession number NP_446452.2) Mouse: 94% identity (180/191 amino acids identical) Human: 84% identity (161/191 amino acids identical) < 50% identity with Kv2.1 and other Kv2 channels 100% identity with Kv2.2 short isoform for first 47 amino acids (ENRGSAPQTPPSTARPLPVTTADFPLTTPQHMSTILLEEALPQGQRP)
Expected Banding Pattern	120 kDa
Target	Kv2.2 potassium channel
Validation	T\|Br-IB\|Br-IHC\|KO

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 5 mL

lieferbar

Lieferung vsl. bis 13.06.2024

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern