JavaScript seems to be disabled in your browser. You must have JavaScript enabled in your browser to utilize the functionality of this website.
Immunogen:Fusion protein amino acids 717-907 (cytoplasmic C-terminus) of rat Kv2.2 long isoform (also known as Potassium voltage-gated channel subfamily B member 2, Kcnb2 and CDRK, accession number NP_446452.2)Mouse: 94% identity (180/191 amino acids identical)Human: 84% identity (161/191 amino acids identical)< 50% identity with Kv2.1 and other Kv2 channels100% identity with Kv2.2 short isoform for first 47 amino acids(ENRGSAPQTPPSTARPLPVTTADFPLTTPQHMSTILLEEALPQGQRP)
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.
Request Data Sheet
Request product datasheet
Request safety datasheet
Delivery expected until 5/30/2024
Compare
Add to wishlist
Recommend by mail
Get an offer
Request delivery time
Ask a technical question
Submit a bulk request
sales@hoelzel.de
« Back
Subscribe, get 15% off every fifth order and have your items delivered on time!
Forgot Your Password?
Not yet registered? Create account here!