« Zurück
Startseite /
Anti-Kir6.2 Potassium Channel Antibody

Anti-Kir6.2 Potassium Channel Antibody

ArtNr	75-393
Hersteller	Antibodies Incorporated
Menge	100 uL
Kategorie	Antibodies Immunohistochemistry Immunocytochemistry Cardiovascular Research Ischemia & Reperfusion Injury Primary Antibodies
Typ	Antibody Monoclonal
Format	Liquid
Applikationen	WB, IHC, ICC
Clon	N363/71
Specific against	Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host	Mouse
Isotype	IgG1
Konjugat/Tag	Unconjugated
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	ATP-sensitive inward rectifier potassium channel 11 (BIR) (Inward rectifier K(+) channel Kir6.2) (Potassium channel, inwardly rectifying subfamily J member 11)
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Primary Antibody
Manufacturer - Targets	Kir6.2 potassium channel
Country of Origin	United States
Shipping Temperature	Shipped on ice packs
Storage Conditions	Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C. For maximum recovery of product, centrifuge the vial prior to removing the cap.
Molecular Weight	45 kDa
Manufacturer - Research Area	Ion Channels and Modulators, K+ Channels
Expiration	24 months from date of receipt
Immunogen	Fusion protein amino acids 345-390 (TARQLDEDRSLLDALTLASSRGPLRKRSVAVAKAKPKFSISPDSLS, cytoplasmic C-terminus) of rat Kir6.2 (accession number P70673) produced recombinantly in E. Coli
Immunogen Species	Rat
Description	Our Anti-Kir6.2 potassium channel mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N363/71. It detects mouse and rat Kir6.2 potassium channel, and is purified by Protein A chromatography. It is great for use in IHC, ICC.
Target Description	ATP-sensitive inward rectifier potassium channel 11 or Kir6.2 is encoded by the gene KCNJ11. Kir6.2 is an integral membrane protein which has a greater tendency to allow potassium to flow into a cell rather than out of a cell, is controlled by G-proteins. Kir6.2 has broad expression in many tissues including brain, heart, pancreas (beta cells) and thyroid. Diseases associated with this gene include several forms of diabetes.
Clonality	Monoclonal
Manufacturer - Specificity	Does not cross-react with Kir6.1
Concentration	1 mg/mL
Form	Purified by Protein A chromatography
Buffer	10 mM Tris, 50 mM Sodium Chloride, 0.065% Sodium Azide pH 7.125
Production Notes	Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography. Purified mAbs are >90% specific antibody.
Quality Control	Each new lot of antibody is quality control tested on cells overexpressing target protein and confirmed to give the expected staining pattern.
Quality Control: Application	ICC
Usage Statement	These antibodies are to be used as research laboratory reagents and are not for use as diagnostic or therapeutic reagents in humans.
Manufacturer - Statement	We produce our Kir6.2 potassium channel mouse monoclonal primary antibody from hybridoma clone N363/71. It is great in IHC, ICC and is purified by Protein A chromatography.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 uL

lieferbar

Lieferung vsl. bis 28.08.2025

Express-Lieferung: 7 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern