« Zurück
Home /
Anti-GluA2/GluR2 Glutamate Receptor Antibody

Anti-GluA2/GluR2 Glutamate Receptor Antibody

ArtNr	75-002
Hersteller	Antibodies Incorporated
Menge	100 uL
Kategorie	Neuroscience Molecular Targets for Neuroscience Neural Signaling Antibodies Immunohistochemistry Primary Antibodies Immunoblot
Typ	Antibody Monoclonal
Format	Liquid
Applikationen	WB, IP, IHC, ICC, EM
Clon	L21/32
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host	Mouse
Isotype	IgG1
Konjugat/Tag	Unconjugated
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	Glutamate receptor 2 (GluR-2) (AMPA-selective glutamate receptor 2) (GluR-B) (GluR-K2) (Glutamate receptor ionotropic, AMPA 2) (GluA2)
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Primary Antibody
Manufacturer - Targets	GluA2/GluR2 glutamate receptor
Country of Origin	United States
Shipping Temperature	Shipped on ice packs
Storage Conditions	Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C. For maximum recovery of product, centrifuge the vial prior to removing the cap.
Molecular Weight	90 kDa
Manufacturer - Research Area	Post-synaptic Markers, Neurotransmitter Receptors
Expiration	24 months from date of receipt
Immunogen	Fusion protein amino acids 834-883 (EFCYKSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGYNVYGIESVKI, cytoplasmic C-terminus) of rat GluA2/GluR2 produced recombinantly in E. Coli
Immunogen Species	Rat
Target Description	Glutelin type-A 2 (GluA2) , also called GRIA2, GLUR2, GLURB, GluA2, GluR-K2, HBGR2 or glutamate ionotropic receptor AMPA type subunit 2, is a member of the Glutamate receptor family of the mammalian brain. This neurotransmiter receptor subunit, which is activated during normal central nervous system fuction, is encoded by the GRIA2 (or GLUR2) gene. GluA2 constitutes a key subunit that regulates AMPA receptors. AMPA receptors lacking of Glua2 have been shown to be present in diseased brains, whose basic fuctions have been altered.
Clonality	Monoclonal
Manufacturer - Specificity	Does not cross-react with GluA1/GluR1, GluA3/GluR3 or GluA4/GluR4 (based on KO validation results)
Concentration	1 mg/mL
Form	Purified by Protein A chromatography
Manufacturer - Format	Liquid
Buffer	10 mM Tris, 50 mM Sodium Chloride, 0.065% Sodium Azide pH 7.4
Production Notes	Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography. Purified mAbs are >90% specific antibody.
Quality Control	Each new lot of antibody is quality control tested by western blot on rat whole brain lysate and confirmed to stain the expected molecular weight band.
Quality Control: Application	WB Brain
Dilution Range: WB	1:500
Dilution Range: IHC	1:250
Dilution Range: ICC	1:500
Usage Statement	These antibodies are to be used as research laboratory reagents and are not for use as diagnostic or therapeutic reagents in humans.
Manufacturer - Statement	We produce our GluA2/GluR2 glutamate receptor mouse monoclonal primary antibody from hybridoma clone L21/32. It is great in EM, IHC, ICC, IP, WB and is purified by Protein A chromatography.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 uL

lieferbar

Lieferung vsl. bis 29.05.2025

Express-Lieferung: 10 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail