Item no. |
75-002 |
Manufacturer |
Antibodies Incorporated
|
Amount |
100 uL |
Category |
|
Type |
Antibody Monoclonal |
Format |
Liquid |
Applications |
WB, IP, IHC, ICC, EM |
Clone |
L21/32 |
Specific against |
Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus) |
Host |
Mouse |
Isotype |
IgG1 |
Conjugate/Tag |
Unconjugated |
ECLASS 10.1 |
42030590 |
ECLASS 11.0 |
42030590 |
UNSPSC |
12352203 |
Alias |
Glutamate receptor 2 (GluR-2) (AMPA-selective glutamate receptor 2) (GluR-B) (GluR-K2) (Glutamate receptor ionotropic, AMPA 2) (GluA2) |
Shipping condition |
Cool pack |
Available |
|
Manufacturer - Type |
Primary Antibody |
Manufacturer - Targets |
GluA2/GluR2 glutamate receptor |
Country of Origin |
United States |
Shipping Temperature |
Shipped on ice packs |
Storage Conditions |
Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C. For maximum recovery of product, centrifuge the vial prior to removing the cap. |
Molecular Weight |
90 kDa |
Manufacturer - Research Area |
Post-synaptic Markers, Neurotransmitter Receptors |
Expiration |
24 months from date of receipt |
Immunogen |
Fusion protein amino acids 834-883 (EFCYKSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGYNVYGIESVKI, cytoplasmic C-terminus) of rat GluA2/GluR2 produced recombinantly in E. Coli |
Immunogen Species |
Rat |
Target Description |
Glutelin type-A 2 (GluA2) , also called GRIA2, GLUR2, GLURB, GluA2, GluR-K2, HBGR2 or glutamate ionotropic receptor AMPA type subunit 2, is a member of the Glutamate receptor family of the mammalian brain. This neurotransmiter receptor subunit, which is activated during normal central nervous system fuction, is encoded by the GRIA2 (or GLUR2) gene. GluA2 constitutes a key subunit that regulates AMPA receptors. AMPA receptors lacking of Glua2 have been shown to be present in diseased brains, whose basic fuctions have been altered. |
Clonality |
Monoclonal |
Manufacturer - Specificity |
Does not cross-react with GluA1/GluR1, GluA3/GluR3 or GluA4/GluR4 (based on KO validation results) |
Concentration |
1 mg/mL |
Form |
Purified by Protein A chromatography |
Manufacturer - Format |
Liquid |
Buffer |
10 mM Tris, 50 mM Sodium Chloride, 0.065% Sodium Azide pH 7.4 |
Production Notes |
Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography. Purified mAbs are >90% specific antibody. |
Quality Control |
Each new lot of antibody is quality control tested by western blot on rat whole brain lysate and confirmed to stain the expected molecular weight band. |
Quality Control: Application |
WB Brain |
Dilution Range: WB |
1:500 |
Dilution Range: IHC |
1:250 |
Dilution Range: ICC |
1:500 |
Usage Statement |
These antibodies are to be used as research laboratory reagents and are not for use as diagnostic or therapeutic reagents in humans. |
Manufacturer - Statement |
We produce our GluA2/GluR2 glutamate receptor mouse monoclonal primary antibody from hybridoma clone L21/32. It is great in EM, IHC, ICC, IP, WB and is purified by Protein A chromatography. |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.