Vergleich

Anti-SUR2A Antibody

ArtNr 75-296
Hersteller Antibodies Incorporated
Menge 100 uL
Kategorie
Typ Antibody Monoclonal
Format Liquid
Applikationen WB, IHC, ICC
Clon N319A/14
Specific against Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host Mouse
Isotype IgG2a
Konjugat/Tag Unconjugated
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias ATP-binding cassette sub-family C member 9 (Sulfonylurea receptor 2)
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Type
Primary Antibody
Manufacturer - Targets
SUR2A
Country of Origin
United States
Shipping Temperature
Shipped on ice packs
Storage Conditions
Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C. For maximum recovery of product, centrifuge the vial prior to removing the cap.
Molecular Weight
120 kDa
Manufacturer - Research Area
Ion Channels and Modulators, Ion Channel Modulators
Expiration
24 months from date of receipt
Immunogen
Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A (accession number P70170) produced recombinantly in E. Coli
Immunogen Species
Mouse
Description
Our Anti-SUR2A mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N319A/14. It is KO validated, detects mouse and rat SUR2A, and is purified by Protein A chromatography. It is great for use in IHC, ICC, WB.
Target Description
Sulfonylurea receptor 2A (SUR2A), or ATP binding cassette transporter subfamily C member 9 is encoded by the gene ABCC9 and is a member of the ABC transporter super family. Differential splicing of the ABCC9 gene produces 2 isoforms, SUR2A and SUR2B. SUR2A forms cardiac and smooth muscle-type KATP channels with KCNJ11(Kir6.2) and is involved in regulation and activation. Diseases associated with this gene include Cantu Syndrome and Dilated Cardiomyopathy 1O.
Clonality
Monoclonal
Manufacturer - Specificity
Does not cross-react with SUR2B
Concentration
1 mg/mL
Form
Purified by Protein A chromatography
Buffer
10 mM Tris, 50 mM Sodium Chloride, 0.065% Sodium Azide pH 7.125
Production Notes
Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography. Purified mAbs are >90% specific antibody.
Quality Control
Each new lot of antibody is quality control tested on cells overexpressing target protein and confirmed to give the expected staining pattern.
Quality Control: Application
ICC
Usage Statement
These antibodies are to be used as research laboratory reagents and are not for use as diagnostic or therapeutic reagents in humans.
Manufacturer - Statement
We produce our SUR2A mouse monoclonal primary antibody from hybridoma clone N319A/14. It is great in IHC, ICC, WB and is purified by Protein A chromatography.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 uL
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen