FXR1 Antibody

ArtNr	OAAN01612-100UL
Hersteller	AVIVA Systems Biology
Menge	100 ul
Kategorie	Neuroscience Neural Transcription Factors Molecular Targets for Neuroscience Antibodies Western Blot Immunofluorescence Primary Antibodies
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB, IF
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host	Rabbit
Isotype	IgG
Konjugat/Tag	Unconjugated
Sequence	VTAIELDEDTGTFRIYGESADAVKKARGFLEFVEDFIQVPRNLVGKVIGKNGKVIQEIVDKSGVVRVRIEGDNENKLPREDGMVPFVFVGTKESIGNVQVL
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	FXR1P,MYOPMIL,MYORIBF
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Molecular Weight	70 kDa
Manufacturer - Application Additional Information	WB: 1:500 - 1:2000IF: 1:50 - 1:200Optimal dilutions should be determined by the end user.
Gene symbol	FXR1
Gene Fullname	FMR1 autosomal homolog 1
Product format	Liquid.PBS with 0.02% sodium azide, 50% glycerol, pH 7.3
Reconstitution and storage	Store at -20C. Avoid repeated freeze/thaw cycles.
Description of target	The protein encoded by this gene is an RNA binding protein that interacts with the functionally-similar proteins FMR1 and FXR2. These proteins shuttle between the nucleus and cytoplasm and associate with polyribosomes, predominantly with the 60S ribosomal subunit. Three transcript variants encoding different isoforms have been found for this gene.
Nucleotide accession_num	NM_001013438.2
Protein accession_num	NP_001013456.1
Protein name	Fragile X mental retardation syndrome-related protein 1
Clonality	Polyclonal
Purification	Affinity purified
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 250-350 of human FXR1 (NP_005078.2).

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OAAN01612-100UL-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ul

lieferbar

Lieferung vsl. bis 11.12.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern