« Back
Home /
FXR1 Antibody

FXR1 Antibody

Item no.	OAAN01612-100UL
Manufacturer	AVIVA Systems Biology
Amount	100 ul
Category	Neuroscience Neural Transcription Factors Molecular Targets for Neuroscience Antibodies Western Blot Immunofluorescence Primary Antibodies
Type	Antibody Polyclonal
Format	Liquid
Applications	WB, IF
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Sequence	VTAIELDEDTGTFRIYGESADAVKKARGFLEFVEDFIQVPRNLVGKVIGKNGKVIQEIVDKSGVVRVRIEGDNENKLPREDGMVPFVFVGTKESIGNVQVL
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	FXR1P,MYOPMIL,MYORIBF
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Molecular Weight	70 kDa
Manufacturer - Application Additional Information	WB: 1:500 - 1:2000IF: 1:50 - 1:200Optimal dilutions should be determined by the end user.
Gene symbol	FXR1
Gene Fullname	FMR1 autosomal homolog 1
Product format	Liquid.PBS with 0.02% sodium azide, 50% glycerol, pH 7.3
Reconstitution and storage	Store at -20C. Avoid repeated freeze/thaw cycles.
Description of target	The protein encoded by this gene is an RNA binding protein that interacts with the functionally-similar proteins FMR1 and FXR2. These proteins shuttle between the nucleus and cytoplasm and associate with polyribosomes, predominantly with the 60S ribosomal subunit. Three transcript variants encoding different isoforms have been found for this gene.
Nucleotide accession_num	NM_001013438.2
Protein accession_num	NP_001013456.1
Protein name	Fragile X mental retardation syndrome-related protein 1
Clonality	Polyclonal
Purification	Affinity purified
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 250-350 of human FXR1 (NP_005078.2).

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OAAN01612-100UL-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 12/11/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer