TEAD1 Antibody

ArtNr	OAAN02002-100UL
Hersteller	AVIVA Systems Biology
Menge	100 ul
Kategorie	Antibodies Immunoprecipitation Western Blot Immunofluorescence Primary Antibodies CHiP
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB, IF, CHIP
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host	Rabbit
Isotype	IgG
Konjugat/Tag	Unconjugated
Sequence	AIHNKLGLPGIPRPTFPGAPGFWPGMIQTGQPGSSQDVKPFVQQAYPIQPAVTAPIPGFEPASAPAPSVPAWQGRSIGTTK
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	AA,REF1,TCF13,TEF-1,NTEF-1,TCF-13,TEAD-1
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Molecular Weight	48 kDa
Manufacturer - Application Additional Information	WB: 1:500~2000 IF/ICC: 1:50~200 CHIP: 1:50~200
Gene symbol	TEAD1
Gene Fullname	TEA domain transcription factor 1
Product format	Liquid PBS with 0.02% sodium azide, 50% glycerol (pH 7.3)
Reconstitution and storage	Store at -20°C. Avoid repeated freeze/thaw cycles.
Description of target	This gene encodes a ubiquitous transcriptional enhancer factor that is a member of the TEA/ATTS domain family. This protein directs the transactivation of a wide variety of genes and, in placental cells, also acts as a transcriptional repressor. Mutations in this gene cause Sveinsson' s chorioretinal atrophy. Additional transcript variants have been described but their full-length natures have not been experimentally verified.
Nucleotide accession_num	NM_021961.5
Protein accession_num	NP_068780.2
Protein name	Transcriptional enhancer factor TEF-1
Clonality	Polyclonal
Purification	Affinity purified against immunogen
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 135-215 of human TEAD1 (NP_068780.2).

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OAAN02002-100UL-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ul

lieferbar

Lieferung vsl. bis 30.10.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern