Comparison

TEAD1 Antibody

Item no. OAAN02002-100UL
Manufacturer AVIVA Systems Biology
Amount 100 ul
Category
Type Antibody Polyclonal
Format Liquid
Applications WB, IF, CHIP
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host Rabbit
Isotype IgG
Conjugate/Tag Unconjugated
Sequence AIHNKLGLPGIPRPTFPGAPGFWPGMIQTGQPGSSQDVKPFVQQAYPIQPAVTAPIPGFEPASAPAPSVPAWQGRSIGTTK
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias AA,REF1,TCF13,TEF-1,NTEF-1,TCF-13,TEAD-1
Shipping Condition Cool pack
Available
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature
Wet Ice
Molecular Weight
48 kDa
Manufacturer - Application Additional Information
WB: 1:500~2000
IF/ICC: 1:50~200
CHIP: 1:50~200
Gene symbol
TEAD1
Gene Fullname
TEA domain transcription factor 1
Product format
Liquid PBS with 0.02% sodium azide, 50% glycerol (pH 7.3)
Reconstitution and storage
Store at -20°C. Avoid repeated freeze/thaw cycles.
Description of target
This gene encodes a ubiquitous transcriptional enhancer factor that is a member of the TEA/ATTS domain family. This protein directs the transactivation of a wide variety of genes and, in placental cells, also acts as a transcriptional repressor. Mutations in this gene cause Sveinsson' s chorioretinal atrophy. Additional transcript variants have been described but their full-length natures have not been experimentally verified.
Nucleotide accession_num
NM_021961.5
Protein accession_num
NP_068780.2
Protein name
Transcriptional enhancer factor TEF-1
Clonality
Polyclonal
Purification
Affinity purified against immunogen
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 135-215 of human TEAD1 (NP_068780.2).

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close