Grp75, CT (HSPA9, Glucose Regulated Protein 75, Heat shock 70kD protein 9, Mortalin, Stress-70 protein, mitochondrial, Mot-2, Mthsp75, PBP74, HSPA9B, Mortalin, Perinuclear)

Antibodies / Antibodies-Heat Shock Proteins

-20°C

Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.

Synthetic peptide corresponding to aa646-679, KLFEMAYKKMASEREGSGSSGTGEQKEDQKE -EKQ, of human Grp75 at C-terminal.

HSPA9 (heat shock 70kD protein 9 (mortalin)), also known as GRP75, mot-2, mthsp75, PBP74, HSPA9B, Mortalin, Perinuclear, is a highly conserved member of the HSP70 family of proteins. It functions as a chaperone in the mitochondria, cytoplasm, and centrosome. The HSPA9 gene is mapped to chromosome 5q31.2 based on an alignment of the HSPA9 sequence with the genomic sequence. Knockdown of HSPA9 in erythroid cultures was associated with an increased number of cells in the G0/G1 phase of the cell cycle and accelerated apoptosis. Knockdown of Hspa9 in mouse bone marrow cells, followed by transplantation into wildtype recipients, also resulted in loss of erythroid cell number. Haploinsufficiency for HSPA9 may contribute to abnormal hematopoiesis in myelodysplastic syndromes. This protein plays a role in the control of cell proliferation.

Applications:
Suitable for use in Western Blot, Immunohistochemistry. Other applications not tested.

Recommended Dilution:
Western Blot: 0.1-0.5ug/ml
Immunohistochemistry (paraffin): 0.5-1ug/ml
Optimal dilutions to be determined by the researcher.

Storage and Stability:
Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.