KRIT1, CT (Krev Interaction Trapped Protein 1)

Antibodies / Antibodies-Neuroscience

-20°C

Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.

Synthetic peptide corresponding to a sequence at the C-terminal of human KRIT1 (aa703-736, ENKMSFIVHTKQAGLVVKLLMKLNGQLMPTERNS), different from the related mouse sequence by 1aa. Species Sequence Homology: hamster.

Krev interaction trapped protein 1(KRIT1) is a protein that in humans is encoded by the CCM1 gene. This gene encodes a protein containing four ankyrin repeats, a band 4.1/ezrin/radixin/moesin (FERM) domain, and multiple NPXY sequences. The encoded protein is localized in the nucleus and cytoplasm. It binds to integrin cytoplasmic domain-associated protein-1 alpha (ICAP1alpha), and plays a critical role in beta1-integrin-mediated cell proliferation. It associates with junction proteins and RAS-related protein 1A (Rap1A), which requires the encoded protein for maintaining the integrity of endothelial junctions. It is also a microtubule-associated protein and may play a role in microtubule targeting. Mutations in this gene result in cerebral cavernous malformations. Multiple alternatively spliced transcript variants have been found for this gene.

Applications: 
Suitable for use in Western Blot. Other applications not tested.

Recommended Dilution:
Western Blot: 0.1-0.5ug/ml
Optimal dilutions to be determined by the researcher.

Storage and Stability:
Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.