Comparison

KRIT1, CT (Krev Interaction Trapped Protein 1)

Item no. USB-370998
Manufacturer United States Biological
Amount 100 ug
Category
Type Antibody Polyclonal
Format Lyophilized
Applications WB
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host Rabbit
Isotype IgG
Purity Purified by immunoaffinity chromatography.
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Shipping Condition Cool pack
Available
Manufacturer - Type
Pab
Manufacturer - Category
Antibodies / Antibodies-Neuroscience
Shipping Temperature
Blue Ice
Storage Conditions
-20°C
Grade
Affinity Purified
Form
Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
EU Commodity Code
30021010
Immunogen
Synthetic peptide corresponding to a sequence at the C-terminal of human KRIT1 (aa703-736, ENKMSFIVHTKQAGLVVKLLMKLNGQLMPTERNS), different from the related mouse sequence by 1aa. Species Sequence Homology: hamster.
Specificity
Recognizes human KRIT1. Species Crossreactivity: mouse, rat
Description
Krev interaction trapped protein 1(KRIT1) is a protein that in humans is encoded by the CCM1 gene. This gene encodes a protein containing four ankyrin repeats, a band 4.1/ezrin/radixin/moesin (FERM) domain, and multiple NPXY sequences. The encoded protein is localized in the nucleus and cytoplasm. It binds to integrin cytoplasmic domain-associated protein-1 alpha (ICAP1alpha), and plays a critical role in beta1-integrin-mediated cell proliferation. It associates with junction proteins and RAS-related protein 1A (Rap1A), which requires the encoded protein for maintaining the integrity of endothelial junctions. It is also a microtubule-associated protein and may play a role in microtubule targeting. Mutations in this gene result in cerebral cavernous malformations. Multiple alternatively spliced transcript variants have been found for this gene.

Applications: 
Suitable for use in Western Blot. Other applications not tested.

Recommended Dilution:
Western Blot: 0.1-0.5ug/ml
Optimal dilutions to be determined by the researcher.

Storage and Stability:
Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close