Vergleich

Ki67 Rabbit pAb Europäischer Partner

ArtNr A16919-1000uL
Hersteller Abclonal
Menge 1000 uL
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Kategorie
Typ Antibody Polyclonal
Applikationen WB, IF, ICC, ELISA, IHC-P
Specific against Human (Homo sapiens)
Isotype IgG
Purity Affinity purification
Sequence SLSKPEKLGTTAGQMCSGLPGLSSVDINNFGDSINESEGIPLKRRRVSFGGHLRPELFDENLPPNTPLKRGEAPTKRKSLVMHTPPVLKKIIKEQPQPSGKQESGSEIHVEVKAQSLVISPPAPSPRKTPVASDQRRRSCKTAPASSSKSQTEVPKRGGRKSGNLPSKRVSISRSQHDILQMICSKRRSGASEANLIVAKSWADVVKLGAKQTQTKVIKHG
NCBI MKI67
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias KIA,MIB-,MIB-1,PPP1R105,Ki67
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Background
Enables protein C-terminus binding activity. Involved in regulation of chromosome segregation and regulation of mitotic nuclear division. Located in chromosome; nuclear body; and nucleolus. Colocalizes with condensed chromosome. Implicated in Crohn's disease; breast cancer; human immunodeficiency virus infectious disease; and pancreatic cancer. Biomarker of several diseases, including Barrett's esophagus; autoimmune disease of musculoskeletal system (multiple); endocrine gland cancer (multiple); gastrointestinal system cancer (multiple); and interstitial cystitis.
Manufacturer - Cross Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 460-680 of human Ki67 (NP_002408.3).
Recommended Dilution
WB, 1:500 - 1:1000|IF/ICC, 1:50 - 1:200
Protein Size
359kDa
Route
Recombinant Protein
Manufacturer - Research Area
Epigenetics Nuclear Signaling, RNA Binding, Cancer, Tumor biomarkers, Cell Biology Developmental Biology, Cell Cycle, Neuroscience, Cell Type Marker, Neuron marker

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 1000 uL
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen