ARHGAP30 Rabbit pAb

ArtNr	A17847-100ul
Hersteller	Abclonal
Menge	100 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Kategorie	Neuroscience Neural Signaling Antibodies Cell Biology Cytoskeleton Western Blot ELISA Immunofluorescence Immunocytochemistry Primary Antibodies Immunostaining Immunochemistry small GTPases Rho Subfamily
Typ	Antibody Primary
Applikationen	WB, IF, ICC, ELISA
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	PLADSGPDDLAPALEDSLSQEVQDSFSFLEDSSSSEPEWVGAEDGEVAQAEAAGAAFSPGEDDPGMGYLEELLGVGPQVEEFSVEPPLDDLSLDEAQFVLA
NCBI	ARHGAP30
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	ARHGAP30
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Protein Weight	119kDa
Background	Predicted to enable GTPase activator activity. Predicted to be involved in small GTPase mediated signal transduction. Located in intracellular membrane-bounded organelle.
Manufacturer - Cross Reactivity	Human, Mouse
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 485-585 of human ARHGAP30 (NP_859071.2).
Recommended Dilution	WB, 1:500 - 1:2000\|IF/ICC, 1:50 - 1:200
Protein Size	119kDa
Route	Recombinant protein
Manufacturer - Research Area	Signal Transduction, G protein signaling, Small G proteins.
Antigen Seq	PLADSGPDDLAPALEDSLSQEVQDSFSFLEDSSSSEPEWVGAEDGEVAQAEAAGAAFSPGEDDPGMGYLEELLGVGPQVEEFSVEPPLDDLSLDEAQFVLA
Manufacturer - Gene ID (Human)	257106
Expected Protein Size	119kDa
Gene Symbol	ARHGAP30

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

A17847-100ul-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ul

lieferbar

Lieferung vsl. bis 18.12.2025