Vergleich

NTRK1/NTRK2/NTRK3 Rabbit pAb Europäischer Partner

ArtNr A18809-50ul
Hersteller Abclonal
Menge 50 ul
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Kategorie
Typ Antibody Primary
Applikationen WB, IF, ICC, ELISA
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Purity Affinity purification
Sequence LYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVLG
NCBI NTRK1/NTRK2/NTRK3
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Background
Neurotrophic tyrosine kinase (NTRK) is a family of receptor tyrosine kinase.The NTRK gene family contains three members, NTRK1, NTRK2 and NTRK3, which produce TRKA, TRKB and TRKC proteins, respectively.TRK kinases leads to cell differentiation and may play important roles in normal neural functions.Rearrangements in the NTRK genes can result in two genes fusing together and producing altered TRK proteins, which can lead to uncontrolled growth of cancer cells. Neurotrophic tyrosine receptor kinase (NTRK) gene fusions are an actionable biomarker for cancer therapy and can be found in over 25 different types of cancer.
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 700-796 of human NTRK1/NTRK2/NTRK3 (NP_002520.2).
Recommended Dilution
WB, 1:100 - 1:500|IF/ICC, 1:50 - 1:200
Route
Synthetic peptide

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 50 ul
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen