SARS-CoV-2 ORF7a Rabbit pAb

Polyclonal Antibodies

Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.

Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that direct virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ ORF7a encodes a viral accessory protein. Based on its similarity to other coronavirus proteins, ORF7a protein is thought to be a type I transmembrane protein.

Recombinant fusion protein containing a sequence corresponding to amino acids 16-98 of coronavirus ORF7a (YP_009724395.1).

14kDa

ELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYS

ORF7a