Vergleich

XCP1 Rabbit pAb Europäischer Partner

ArtNr A22853-1000uL
Hersteller Abclonal
Menge 1000 uL
Quantity options 1000 uL 100 uL 200 uL 20 uL 500 uL 50 uL
Kategorie
Typ Antibody Polyclonal
Applikationen WB, ELISA
Specific against other
Isotype IgG
Konjugat/Tag Unconjugated
Purity Affinity purification
NCBI 100283433
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias IDP105,GRMZM2G066326,XCP1,Cysteine protease5
Versandbedingung Gekühlt
Lieferbar
Specificity Maize
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Protein Weight
71kDa
Availability
Inquiry before order
Background
XCP1 is a xylem-specific papain-like cysteine peptidase in Arabidopsis. Results from confocal microscopy and biochemical subcellular fractionation indicated that XCP1 was localized in the vacuole. Ectopic expression of XCP1 resulted in a reduction in plant size in some lines and early leaf senescence, as indicated by early loss of leaf chlorophyll. Reduced plant size was correlated with higher levels of XCP1, as shown by immunoblot and peptidase activity gel analyses. The XCP1 prodomain exhibits exceptionally high similarity (greater than 80%) to the prodomains of papain and other papain-like enzymes isolated from papaya (Carica papaya) laticifers when compared with all other reported papain-like enzymes. The XCP1 and papain to perform common functions as catalysts of autolytic processing following cell death due to programmed suicide or to wounding is discussed.
Manufacturer - Cross Reactivity
Maize
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 157-377 of maize XCP1(NP_001149806.1).
Recommended Dilution
WB, 1:500 - 1:2000
Protein Size
71kDa
Route
Recombinant protein
Manufacturer - Research Area
Arabidopsis enzymology, Arabidopsis genetics.
Antigen Seq
EVPASVDWRKKGAVTEVKNQGQCGSCWAFSTVAAVEGINQIVTGNLTSLSEQQLVDCSTDGNNGCSGGVMDNAFSFIATGAGLRSEEAYPYLMEEGDCDDRARDGEVLVTISGYEDVPANDEQALVKALAHQPVSVAIEASGRHFQFYSGGVFDGPCGSELDHGVAAVGYGSSKGQDYIIVKNSWGTHWGEKGYIRMKRGTGKPEGLCGINKMASYPTKDH
Expected Protein Size
71kDa
Gene Symbol
100283433

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 1000 uL
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen