Vergleich

PKC alpha Rabbit mAb Europäischer Partner

ArtNr A23187-100uL
Hersteller Abclonal
Menge 100 uL
Quantity options 1000 uL 100 uL 200 uL 20 uL 500 uL 50 uL
Kategorie
Typ Antibody Monoclonal
Applikationen WB, ELISA
Specific against Human (Homo sapiens)
Isotype IgG
Konjugat/Tag Unconjugated
Purity Affinity purification
NCBI PRKCA
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias AAG6,PKCA,PRKACA,PKCI+/-,PKCalpha,PKC-alpha,PKC alpha
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Category
Monoclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight
77kDa
Background
Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play a distinct role in cells. The protein encoded by this gene is one of the PKC family members. This kinase has been reported to play roles in many different cellular processes, such as cell adhesion, cell transformation, cell cycle checkpoint, and cell volume control. Knockout studies in mice suggest that this kinase may be a fundamental regulator of cardiac contractility and Ca(2+) handling in myocytes.
Manufacturer - Cross Reactivity
Human, Mouse
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PKC alpha. (NP_002728.2).
Recommended Dilution
WB, 1:1000 - 1:5000
Protein Size
77kDa
Route
Synthetic peptide
Manufacturer - Research Area
Epigenetics Nuclear Signaling, Epigenetic writers and erasers of core Histones, Protein phosphorylation, Cancer, Signal Transduction, G protein signaling, G-Protein-Coupled Receptors Signaling to MAPK Erk, Kinase, Serine threonine kinases, mTOR Signaling Pathway, ErbB-HER Signaling Pathway, MAPK-Erk Signaling Pathway, Cell Biology Developmental Biology, Apoptosis, Mitochondrial Control of Apoptosis, Inhibition of Apoptosis, Cell Adhesion, Cytoskeleton, Microtubules, Actins, TGF-b-Smad Signaling Pathway, Endocrine Metabolism, Immunology Inflammation, B Cell Receptor Signaling Pathway, Neuroscience, Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimer's Disease, Neurodegenerative Diseases Markers, Cardiovascular, Heart, Hypertrophy.
Antigen Seq
LIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNME
Manufacturer - Gene ID (Human)
5578
Expected Protein Size
77kDa
Gene Symbol
PRKCA

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 uL
Lieferbar: In stock
lieferbar

Lieferung vsl. bis 18.12.2025 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen