Vergleich

Acetyl-Histone H4-K12 Rabbit mAb Europäischer Partner

ArtNr A23683-500uL
Hersteller Abclonal
Menge 500 uL
Quantity options 1000 uL 100 uL 200 uL 20 uL 500 uL 50 uL
Kategorie
Typ Antibody Monoclonal
Applikationen WB, IP, ELISA, IHC-P, CHIP
Specific against Human (Homo sapiens)
Isotype IgG
Konjugat/Tag Unconjugated
Purity Affinity purification
Sequence MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG
NCBI Histone H4
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias H4/I,H4C1,H4C3,H4C4,H4C5,H4C6,H4C8,H4C9,H4FI,H4-16,H4C11,H4C12,H4C13,H4C14,H4C15,H4C16,HIST1H4B,Acetyl-Histone H4-K12
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Category
Acetylated Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight
11kDa
Background
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H4 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6.
Manufacturer - Cross Reactivity
Human, Mouse, Rat, Other (Wide Range Predicted)
Immunogen
A synthetic acetylated peptide around K12 of human Histone H4 (NP_003486.1).
Recommended Dilution
CHIP, 1:50 - 1:100|IHC-P, 1:500 - 1:1000|IP, 1:500 - 1:1000
Protein Size
11kDa
Route
Synthetic peptide
Manufacturer - Research Area
Epigenetics & Nuclear Signaling, Epigenetic Modifications, Acetylation, Epigenetics & Nuclear Signaling, Epigenetic Modifications, Acetylation, Epigenetics & Nuclear Signaling, Epigenetic Modifications, Acetylation.
Antigen Seq
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG
Manufacturer - Gene ID (Human)
8359/8370
Expected Protein Size
11kDa
Gene Symbol
Histone H4

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 500 uL
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen