« Zurück
Startseite /
ICOS/CD278 Rabbit mAb

ICOS/CD278 Rabbit mAb

ArtNr	A23995-100uL
Hersteller	Abclonal
Menge	100 uL
Quantity options	1000 uL 100 uL 200 uL 20 uL 500 uL 50 uL
Kategorie	Oncology Antibodies By Cell Type Hematology Lymphoma Flow Cytometry Western Blot ELISA Immunofluorescence Immunocytochemistry Primary Antibodies Immunostaining Immunochemistry
Typ	Antibody Monoclonal
Applikationen	WB, FC, IF, ICC, ELISA
Specific against	Mouse (Murine, Mus musculus)
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	EINGSADHRMFSFHNGGVQISCKYPETVQQLKMRLFREREVLCELTKTKGSGNAVSIKNPMLCLYHLSNNSVSFFLNNPDSSQGSYYFCSLSIFDPPPFQERNLSGGYLHIYESQLCCQLKL
NCBI	Icos/CD278
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	H4,CCLP,AILIM,CRP-1,Ly115,ICOS/CD278
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Category	Monoclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight	22kDa
Background	Predicted to be involved in T cell costimulation; T cell tolerance induction; and cell-cell adhesion. Located in external side of plasma membrane. Is integral component of plasma membrane. Used to study common variable immunodeficiency. Human ortholog(s) of this gene implicated in celiac disease; common variable immunodeficiency; and immunoglobulin alpha deficiency. Orthologous to human ICOS (inducible T cell costimulator).
Manufacturer - Cross Reactivity	Mouse
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 21-142 of mouse ICOS/CD278(NP_059508.2).
Recommended Dilution	WB, 1:1000 - 1:5000\|IF/ICC, 1:50 - 1:200\|FC, 1:500 - 1:1000
Protein Size	22kDa
Route	Recombinant protein
Manufacturer - Research Area	Immunology Inflammation, CDs.
Antigen Seq	EINGSADHRMFSFHNGGVQISCKYPETVQQLKMRLFREREVLCELTKTKGSGNAVSIKNPMLCLYHLSNNSVSFFLNNPDSSQGSYYFCSLSIFDPPPFQERNLSGGYLHIYESQLCCQLKL
Manufacturer - Gene ID (Human)	29851
Expected Protein Size	22kDa
Gene Symbol	Icos/CD278

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

A23995-100uL-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 uL

lieferbar

Lieferung vsl. bis 27.11.2025