Vergleich

SFTPA1 Rabbit pAb Europäischer Partner

ArtNr A24870-200uL
Hersteller Abclonal
Menge 200 uL
Quantity options 1000 uL 100 uL 200 uL 20 uL 500 uL 50 uL
Kategorie
Typ Antibody Polyclonal
Applikationen WB
Specific against Human (Homo sapiens)
Isotype IgG
Konjugat/Tag Unconjugated
Purity Affinity purification
NCBI SFTPA1/SFTPA2
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias SPA,ILD1,PSAP,PSPA,SP-A,SPA1,PSP-A,SFTP1,SP-A1,COLEC4,SFTPA1B,SP-A1 beta,SP-A1 delta,SP-A1 gamma,SP-A1 epsilon,SFTPA1
Lieferbar
Manufacturer - Category
Polyclonal Antibodies
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Protein Weight
26kDa
Background
This gene encodes a lung surfactant protein that is a member of a subfamily of C-type lectins called collectins. The encoded protein binds specific carbohydrate moieties found on lipids and on the surface of microorganisms. This protein plays an essential role in surfactant homeostasis and in the defense against respiratory pathogens. Mutations in this gene are associated with idiopathic pulmonary fibrosis. Alternate splicing results in multiple transcript variants.
Manufacturer - Cross Reactivity
Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 100-248 of human SFTPA1 (NP_001158116.1).
Recommended Dilution
WB, 1:500 - 1:1000
Route
Recombinant protein
Manufacturer - Research Area
Cytoskeleton, Extracellular Matrix.
Antigen Seq
PAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF
Manufacturer - Gene ID (Human)
653509/729238
Expected Protein Size
26kDa
Gene Symbol
SFTPA1/SFTPA2

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 200 uL
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen