« Zurück
Startseite /
Anti-Grp75 Picoband Antibody

Anti-Grp75 Picoband Antibody

ArtNr	ABC-ABO12328
Hersteller	Abcepta
Menge	100 ug
Kategorie	Antibodies Primary Antibodies
Typ	Antibody Primary
Format	Lyophilized
Applikationen	WB, IHC-P
Specific against	other
Host	Rabbit
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Similar products	HSPA9, mitochondrial, GRP75, PBP74, HSPA9B, MOT, 75 kDa glucose-regulated protein, Mortalin, Stress-70 protein, Heat shock 70 kDa protein 9, GRP-75, Peptide-binding protein 74, mt-HSP70
Lieferbar
Primary Accession	P38646
Application	WB, IHC-P
Clonality	Polyclonal
Gene ID	3313
Reactivity	H, M, Rat
Legend image 1	Anti- Grp75 Picoband antibody, ABO12328, Western blottingAll lanes: Anti Grp75 (ABO12328) at 0.5ug/mlLane 1: Rat Liver Tissue Lysate at 50ugLane 2: Rat Thymus Tissue Lysate at 50ugLane 3: Rat Testis Tissue Lysate at 50ugLane 4: Mouse Liver Tissue Lysate at 50ugLane 5: Mouse Thymus Tissue Lysate at 50ugLane 6: Mouse Testis Tissue Lysate at 50ugLane 7: HELA Whole Cell Lysate at 40ugLane 8: MCF-7 Whole Cell Lysate at 40ugLane 9: SW620 Whole Cell Lysate at 40ugLane 10: SMMC Whole Cell Lysate at 40ugPredicted bind size: 74KDObserved bind size: 74KD
Type image 1	WB
Dilution image 1	0.1-0.5 µg/ml
Legend image 2	Anti- Grp75 Picoband antibody, ABO12328, IHC(P)IHC(P): Mouse Kidney Tissue
Type image 2	IHC
Dilution image 2	0.5-1 µg/ml
Legend image 3	Anti- Grp75 Picoband antibody, ABO12328, IHC(P)IHC(P): Rat Kidney Tissue
Type image 3	IHC
Legend image 4	Anti- Grp75 Picoband antibody, ABO12328, IHC(P)IHC(P): Human Intestinal Cancer Tissue
Type image 4	IHC
Calculated MW	73680
Reconstitution	Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Description	Rabbit IgG polyclonal antibody for Stress-70 protein, mitochondrial(HSPA9) detection. Tested with WB, IHC-P in Human; Mouse; Rat.
Protein Function	Implicated in the control of cell proliferation and cellular aging. May also act as a chaperone. .
Subcellular Localization	Mitochondrion . Nucleus, nucleolus .
Protein Name	Stress-70 protein, mitochondrial
Contents	Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human Grp75 (646-679aa KLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ), identical to the related mouse and rat sequences.
Purification	Immunogen affinity purified.
Cross Reactivity	No cross reactivity with other proteins
Storage	At -20?C for one year. After r?Constitution, at 4?C for one month. It?Can also be aliquotted and stored frozen at -20?C for a longer time.Avoid repeated freezing and thawing.
Concentration (mg/ml)	Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

ABC-ABO12328-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 06.11.2025

Express-Lieferung: 13 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern