« Back
Home /
Anti-Grp75 Picoband Antibody

Anti-Grp75 Picoband Antibody

Item no.	ABC-ABO12328
Manufacturer	Abcepta
Amount	100 ug
Category	Antibodies Primary Antibodies
Type	Antibody Primary
Format	Lyophilized
Applications	WB, IHC-P
Specific against	other
Host	Rabbit
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Similar products	HSPA9, mitochondrial, GRP75, PBP74, HSPA9B, MOT, 75 kDa glucose-regulated protein, Mortalin, Stress-70 protein, Heat shock 70 kDa protein 9, GRP-75, Peptide-binding protein 74, mt-HSP70
Available
Primary Accession	P38646
Application	WB, IHC-P
Clonality	Polyclonal
Gene ID	3313
Reactivity	H, M, Rat
Legend image 1	Anti- Grp75 Picoband antibody, ABO12328, Western blottingAll lanes: Anti Grp75 (ABO12328) at 0.5ug/mlLane 1: Rat Liver Tissue Lysate at 50ugLane 2: Rat Thymus Tissue Lysate at 50ugLane 3: Rat Testis Tissue Lysate at 50ugLane 4: Mouse Liver Tissue Lysate at 50ugLane 5: Mouse Thymus Tissue Lysate at 50ugLane 6: Mouse Testis Tissue Lysate at 50ugLane 7: HELA Whole Cell Lysate at 40ugLane 8: MCF-7 Whole Cell Lysate at 40ugLane 9: SW620 Whole Cell Lysate at 40ugLane 10: SMMC Whole Cell Lysate at 40ugPredicted bind size: 74KDObserved bind size: 74KD
Type image 1	WB
Dilution image 1	0.1-0.5 µg/ml
Legend image 2	Anti- Grp75 Picoband antibody, ABO12328, IHC(P)IHC(P): Mouse Kidney Tissue
Type image 2	IHC
Dilution image 2	0.5-1 µg/ml
Legend image 3	Anti- Grp75 Picoband antibody, ABO12328, IHC(P)IHC(P): Rat Kidney Tissue
Type image 3	IHC
Legend image 4	Anti- Grp75 Picoband antibody, ABO12328, IHC(P)IHC(P): Human Intestinal Cancer Tissue
Type image 4	IHC
Calculated MW	73680
Reconstitution	Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Description	Rabbit IgG polyclonal antibody for Stress-70 protein, mitochondrial(HSPA9) detection. Tested with WB, IHC-P in Human; Mouse; Rat.
Protein Function	Implicated in the control of cell proliferation and cellular aging. May also act as a chaperone. .
Subcellular Localization	Mitochondrion . Nucleus, nucleolus .
Protein Name	Stress-70 protein, mitochondrial
Contents	Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human Grp75 (646-679aa KLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ), identical to the related mouse and rat sequences.
Purification	Immunogen affinity purified.
Cross Reactivity	No cross reactivity with other proteins
Storage	At -20?C for one year. After r?Constitution, at 4?C for one month. It?Can also be aliquotted and stored frozen at -20?C for a longer time.Avoid repeated freezing and thawing.
Concentration (mg/ml)	Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

ABC-ABO12328-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 11/6/2025

Express Delivery: Save 13 days

Compare

Add to wishlist

Get an offer