« Zurück
Startseite /
Anti-Pea3 Picoband Antibody

Anti-Pea3 Picoband Antibody

ArtNr	ABC-ABO12385
Hersteller	Abcepta
Menge	100 ug
Kategorie	Antibodies Western Blot Primary Antibodies
Typ	Antibody Primary
Format	Lyophilized
Applikationen	WB
Specific against	Human (Homo sapiens), Rat (Rattus norvegicus)
Host	Rabbit
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	ETS translocation variant 4,Adenovirus E1A enhancer-binding protein,E1A-F,Polyomavirus enhancer activator 3 homolog,Protein PEA3,ETV4,E1AF,PEA3
Similar products	ETV4, PEA3, E1A-F, E1AF, ETS translocation variant 4, Protein PEA3, Adenovirus E1A enhancer-binding protein, Polyomavirus enhancer activator 3 homolog
Lieferbar
Clonality	Polyclonal
Reactivity	H, Rat
Calculated Molecular Weight	53938
Formulation	Lyophilized
Reconstitution & Storage	Add 0.2 ml of distilled water will yield a concentration of 500 ug/ml.
Description	Rabbit IgG polyclonal antibody for ETS translocation variant 4(ETV4) detection. Tested with WB in Human; Rat.
Protein Function	Transcriptional activator that binds to the enhancer of the adenovirus E1A gene; the core-binding sequence is 5'[AC]GGA[AT]GT-3'.
Subcellular Localization	Nucleus.
Protein Name	ETS translocation variant 4
Contents	Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen	A synthetic peptide corresponding to a sequence at the N-terminus of human Pea3 (1-41aa MERRMKAGYLDQQVPYTFSSKSPGNGSLREALIGPLGKLMD), different from the related mouse sequence by seven amino acids.
Purification	Immunogen affinity purified.
Cross Reactivity	No cross reactivity with other proteins
Concentration	Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Dilution	WB: 0.1-0.5 µg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

ABC-ABO12385-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 06.11.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern