« Back
Home /
Anti-Pea3 Picoband Antibody

Anti-Pea3 Picoband Antibody

Item no.	ABC-ABO12385
Manufacturer	Abcepta
Amount	100 ug
Category	Antibodies Western Blot Primary Antibodies
Type	Antibody Primary
Format	Lyophilized
Applications	WB
Specific against	Human (Homo sapiens), Rat (Rattus norvegicus)
Host	Rabbit
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	ETS translocation variant 4,Adenovirus E1A enhancer-binding protein,E1A-F,Polyomavirus enhancer activator 3 homolog,Protein PEA3,ETV4,E1AF,PEA3
Similar products	ETV4, PEA3, E1A-F, E1AF, ETS translocation variant 4, Protein PEA3, Adenovirus E1A enhancer-binding protein, Polyomavirus enhancer activator 3 homolog
Available
Clonality	Polyclonal
Reactivity	H, Rat
Calculated Molecular Weight	53938
Formulation	Lyophilized
Reconstitution & Storage	Add 0.2 ml of distilled water will yield a concentration of 500 ug/ml.
Description	Rabbit IgG polyclonal antibody for ETS translocation variant 4(ETV4) detection. Tested with WB in Human; Rat.
Protein Function	Transcriptional activator that binds to the enhancer of the adenovirus E1A gene; the core-binding sequence is 5'[AC]GGA[AT]GT-3'.
Subcellular Localization	Nucleus.
Protein Name	ETS translocation variant 4
Contents	Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen	A synthetic peptide corresponding to a sequence at the N-terminus of human Pea3 (1-41aa MERRMKAGYLDQQVPYTFSSKSPGNGSLREALIGPLGKLMD), different from the related mouse sequence by seven amino acids.
Purification	Immunogen affinity purified.
Cross Reactivity	No cross reactivity with other proteins
Concentration	Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Dilution	WB: 0.1-0.5 µg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

ABC-ABO12385-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 11/6/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer