Vergleich

Anti-Syntaxin 1 Europäischer Partner

ArtNr ALO-ANR-002-0.2ml
Hersteller Alomone
Menge 0.2 ml
Quantity options 0.2 ml 25 ul 50 ul
Kategorie
Typ Antibody Polyclonal
Format Lyophilized
Applikationen WB, IF, IHC
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host Rabbit
Isotype IgG
Konjugat/Tag Unconjugated
Purity The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.
Formula PBS pH7.4, 1% BSA with 0.05% sodium azide
Sequence GST fusion protein with the sequence MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQH STLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFM
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Versandbedingung Raumtemperatur
Lieferbar
Specificity Polyclonal
Manufacturer - Type
Antibodies
Manufacturer - Category
Antibodies
Manufacturer - Targets
STX1A, Synaptotagmin-associated 35 kDa protein, P35A, P35-1, Neuron-specific antigen HPC-1
Country of Origin
Israel
Shipping Temperature
Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C
Storage Conditions
Storage before Reconstitution: The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C - Storage after Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).
Manufacturer - Format
Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4
Short description
A Rabbit Polyclonal Antibody to Syntaxin 1
Description
STX1A, Synaptotagmin-associated 35 kDa protein, P35A, P35-1, Neuron-specific antigen HPC-1 - A Rabbit Polyclonal Antibody to Syntaxin 1
Clonality
Polyclonal
Homology
Human, mouse- 264/265 amino acid residues identical
Standard quality control of each lot
Western blot analysis
Peptide confirmation
Confirmed by DNA sequence and SDS-PAGE
Reconstitution
25 μl, 50 μl or 0.2 ml double distilled water (DDW), depending on the sample size.
Antibody Concentration After Reconstitution
0.8 mg/ml
Preservative
1% BSA, 0.05% NaN3
Immunogen Location
Intracellular, N-terminus
Specificity
STX1A
Immunogen source species
Rat
PH
7, 4
UNSPSC
41116161
Antigen Preadsorption Control
3 µg fusion protein per 1 µg antibody
Scientific Background
Syntaxin 1 is a member of the soluble N-ethylmaleimide-sensitive factor attachment protein receptor (SNARE) protein superfamily. The family includes 36 members in humans and is characterized by the SNARE motif, an evolutionarily conserved stretch of 60-70 amino acids that are arranged in heptad repeats1, 2.SNARE proteins are involved in exocytosis and intracellular vesicle trafficking and are essential for cell growth, hormone secretion and neurotransmission, processes that require rapid, targeted, and regulated membrane fusion1, 2.SNAREs can be roughly divided into vesicular (v-SNAREs) and target (t-SNAREs) based on their distribution on the transport vesicle or target membrane respectively. Thus, assembly of cognate v-/t-SNAREs between two opposing membranes generates trans-SNARE complexes, which bring the lipid bilayers in close proximity and drive membrane fusion.Syntaxin 1, like most SNAREs, is a type IV membrane protein with a relatively large N-terminus containing the SNARE motif located in the cytoplasmic side and a transmembrane domain located close to the C-terminus that functions as an anchor1, 2.Syntaxin 1 has been extensively studied for its role on neuronal and neuroendocrine cell exocytosis where it functions as the plasma membrane protein t-SNARE, which together with the vesicular v-SNARE protein VAMP and the membrane-associated SNAP-25 (synaptosome-associated protein 25 kDa), forms a trimeric, four-helical complex, which drives fusion of the two opposing bilayers1, 2.Syntaxin 1 together with SNAP-25 is the target of the neurotoxin botulinum neurotoxin type C (BoNT/C) which following proteolytic degradation of the proteins causes inhibition of neurotransmitter release 3.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 0.2 ml
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen