Vergleich

Anti-KCNH2 (HERG) Antibody Europäischer Partner

ArtNr ALO-APC-062-50ul
Hersteller Alomone
Menge 50 ul
Quantity options 0.2 ml 25 ul 50 ul
Kategorie
Typ Antibody
Format Lyophilized
Applikationen WB, IF, IP, IHC, ICC
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host Rabbit
Isotype IgG
Purity Affinity purified on immobilized antigen.
Formula Lyophilized powder Reconstituted antibody contains phosphate buffered saline (PBS), pH 74, 1% BSA, 005% NaN3
Sequence DSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPGS
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Lieferbar
Specificity Polyclonal
Manufacturer - Type
Antibodies
Manufacturer - Format
Lyophilized powder Reconstituted antibody contains phosphate buffered saline (PBS), pH 74, 1% BSA, 005% NaN3
Short description
A Rabbit Polyclonal Antibody to KV11.1 Channel
Description
Alomone Labs is pleased to offer a highly specific antibody directed against an intracellular epitope of the human KV11.1 channel. Anti-KCNH2 (HERG) Antibody (#APC-062) can be used in western blot, immunoprecipitation, immunohistochemical and immunocytochemical applications. It has been designed to recognize KV11.1 from human, rat, and mouse samples.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 50 ul
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen