Vergleich

Anti-PSD-93 Europäischer Partner

ArtNr ALO-APZ-002-0.2ml
Hersteller Alomone
Menge 0.2 ml
Quantity options 0.2 ml 25 ul 50 ul
Kategorie
Typ Antibody Polyclonal
Format Lyophilized
Applikationen WB, IF, IP, IHC, IC
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host Rabbit
Isotype IgG
Konjugat/Tag Unconjugated
Purity Affinity purified on immobilized antigen.
Formula PBS pH7.4, 1% BSA with 0.05% sodium azide
Sequence GST fusion protein with the sequence VEDDYTRPPEPVYSTVNKLCDKPASPRHYSPVECDKSFLLSTPY, corresponding to amino acid residues 336-379 of rat Chapsyn-110
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Versandbedingung Raumtemperatur
Lieferbar
Specificity Polyclonal
Manufacturer - Type
Antibodies
Manufacturer - Category
Antibodies
Manufacturer - Targets
Discs large homolog 2, Dlg2, Chapsyn-110
Country of Origin
Israel
Shipping Temperature
Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C
Storage Conditions
Storage before Reconstitution: The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C - Storage after Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).
Manufacturer - Format
Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4
Short description
A Rabbit Polyclonal Antibody to PSD-93
Description
Discs large homolog 2, Dlg2, Chapsyn-110 - A Rabbit Polyclonal Antibody to PSD-93
Clonality
Polyclonal
Homology
Human - 42/44 amino acid residues identical
Standard quality control of each lot
Western blot analysis
Peptide confirmation
Confirmed by DNA sequence and SDS-PAGE
Reconstitution
25 μl, 50 μl or 0.2 ml double distilled water (DDW), depending on the sample size.
Antibody Concentration After Reconstitution
1 mg/ml
Preservative
1% BSA, 0.05% NaN3
Immunogen Location
Between PDZ2 and PDZ3 domains.
Specificity
DLG2
Immunogen source species
Rat
PH
7, 4
UNSPSC
41116161
Ko Validate
yes
Antigen Preadsorption Control
3 µg fusion protein per 1 µg antibody
Scientific Background
Chapsyn 110 (also known as PSD-93 and DLG2) is a PDZ containing domain protein that is also a member of the membrane-associated guanylate kinase (MAGUK) family of multi-domain adaptor proteins1, 2.PDZ domains are conserved protein domains of about 90 amino acids involved in protein-protein recognition, protein targeting and assembly of multi-protein complexes. The name PDZ derives from the first three proteins in which these domains were identified: PSD-95 (a 95 kDa protein involved in signaling at the post-synaptic density), DLG (the Drosophila melanogaster Discs Large protein) and ZO-1 (the zonula occludens 1 protein involved in maintenance of epithelial polarity)1, 2.MAGUKs are scaffolding proteins that comprise several modular protein binding motifs including one or more PDZ domains, a Src homology 3 (SH3) domain, and a catalytically inactive guanylate kinase-like domain1, 2.The multidomain nature of PDZ-containing proteins enables them to interact with multiple binding partners and hence organize larger signaling protein complexes.Indeed, Chapsyn 110 has been shown to participate in the postsynaptic density, a dedicated structure formed in postsynaptic nerve terminals that includes a specialized assembly of ion channels, receptors and signaling molecules that are involved in information processing and the modulation of synaptic plasticity1, 2.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 0.2 ml
Lieferbar: In stock
lieferbar

Lieferung vsl. bis 29.01.2026 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen