Vergleich

Anti-Aquaporin 4 Europäischer Partner

ArtNr ALO-AQP-004-25ul
Hersteller Alomone
Menge 25 ul
Quantity options 0.2 ml 25 ul 50 ul
Kategorie
Typ Antibody Polyclonal
Format Lyophilized
Applikationen WB, IF, IHC, IC
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host Rabbit
Isotype IgG
Konjugat/Tag Unconjugated
Purity The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.
Formula PBS pH7.4, 1% BSA with 0.05% sodium azide
Sequence GST fusion protein with the sequence EYVFCPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGDEKKGKDSSGEVLSSV, corresponding to amino acid residues 249-323 of rat AQP4
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Versandbedingung Raumtemperatur
Lieferbar
Specificity Polyclonal
Manufacturer - Type
Antibodies
Manufacturer - Category
Antibodies
Manufacturer - Targets
WCH4, Mercurial-insensitive water channel
Country of Origin
Israel
Shipping Temperature
Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C
Storage Conditions
Storage before Reconstitution: The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C - Storage after Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).
Manufacturer - Format
Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4
Short description
A Rabbit Polyclonal Antibody to Aquaporin 4 (249-323) Channel
Description
WCH4, Mercurial-insensitive water channel - A Rabbit Polyclonal Antibody to Aquaporin 4 (249-323) Channel
Clonality
Polyclonal
Homology
Mouse - 73/75 amino acid residues identical; bovine - 71/75 amino acid residues identical; human - 69/75 amino acid residues identical; rabbit - 64/75 amino acid residues identical
Standard quality control of each lot
Western blot analysis
Peptide confirmation
Confirmed by DNA sequence and SDS-PAGE
Reconstitution
25 µl, 50 µl or 0.2 ml double distilled water (DDW), depending on the sample size.
Antibody Concentration After Reconstitution
0.8 mg/ml
Preservative
1% BSA, 0.05% NaN3
Immunogen Location
Intracellular, C-terminus
Specificity
AQP4
Immunogen source species
Rat
PH
7, 4
UNSPSC
41116161
Ko Validate
yes
Antigen Preadsorption Control
3 µg fusion protein per 1 µg antibody
Scientific Background
Aquaporin 4 (AQP-4) belongs to a family of membrane proteins that allow passage of water and certain solutes through biological membranes. The family is composed of 13 members (AQP-0 to AQP-12).The aquaporins can be divided into two functional groups based on their permeability characteristics: the aquaporins that are only permeated by water and the aquaglyceroporins that are permeated by water and other small solutes such as glycerol. AQP-4 together with AQP-1, AQP-2 and AQP-5 belong to the first group1. Little is known about the function of the two newest members, AQP-11 and AQP-12.The proteins present a conserved structure of six transmembrane domains with intracellular N- and C-termini. The functional channel is a tetramer but each subunit has a separate pore and therefore the functional channel unit, contains four pores1.AQP-4 is the major membrane water channel in the central nervous system. The channel is expressed in astrocyte foot processes in direct contact with capillary vessels in the brain suggesting a role in water transport under normal and pathological conditions. Indeed, transgenic mice lacking AQP-4 have reduced brain swelling and improved neurological outcome following water intoxication and focal cerebral ischemia. In contrast, brain swelling and clinical outcome are worse in AQP-4-null mice in models of vasogenic (fluid leak) edema caused by freeze-injury and brain tumor, probably due to impaired AQP-4-dependent brain water clearance2.In addition, it has been recently shown that neuromyelitis optica (NMO), an inflammatory demyelinating disease that selectively affects optic nerves and spinal cord, is caused by the development of an autoantibody directed against AQP-43.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 25 ul
Lieferbar: In stock
lieferbar

Lieferung vsl. bis 29.01.2026 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen