Anti-Rpn12 Antibody

ArtNr	ANTI-A290-50
Hersteller	Antibodies.com
Menge	50 ul
Kategorie	Antibodies Flow Cytometry Immunohistochemistry Immunoprecipitation Western Blot ELISA Immunocytochemistry Primary Antibodies Immunostaining Immunochemistry Electron Microscopy
Typ	Antibody Primary
Format	Liquid
Applikationen	WB, FC, IP, IHC, ICC, ELISA, IHC-P, EM
Specific against	other
Host	Rabbit
Isotype	IgG
Konjugat/Tag	Unconjugated
Sequence	MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Lieferbar
Specificity	Species independent
Manufacturer - Targets	GFP
Storage Conditions	Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid freeze / thaw cycles.
Product Description	Rabbit polyclonal antibody to GFP.
Clonality	Polyclonal
Immunogen	Recombinant full-length protein corresponding to Green Fluorescent Protein (GFP) from Aequorea victoria.
Manufacturer - Formulation	Supplied as an aliquot of serum with 0.05% Sodium Azide and 1.25% Sodium Chloride.
Recommended dilutions	WB: 1:1, 000-1:2, 500, ICC: 1:200-1:1, 000, Flow Cytometry: 1:100, IHC-P: 1:500-1:1, 000, IHC-Fr: 1:500-1:2, 000, Electron Microscopy: 1:1, 000-1:4, 000
Manufacturer - Specificity	This antibody is reactive against all variants of Aequorea victoria GFP such as S65T-GFP, RS-GFP, YFP, CFP, RFP, and EGFP.
Antigen species	Aequorea victoria

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ul

lieferbar

Lieferung vsl. bis 27.11.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern