« Back
Home /
Anti-Rpn12 Antibody

Anti-Rpn12 Antibody

Item no.	ANTI-A290-50
Manufacturer	Antibodies.com
Amount	50 ul
Category	Antibodies Flow Cytometry Immunohistochemistry Immunoprecipitation Western Blot ELISA Immunocytochemistry Primary Antibodies Immunostaining Immunochemistry Electron Microscopy
Type	Antibody Primary
Format	Liquid
Applications	WB, FC, IP, IHC, ICC, ELISA, IHC-P, EM
Specific against	other
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Sequence	MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Available
Specificity	Species independent
Manufacturer - Targets	GFP
Storage Conditions	Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid freeze / thaw cycles.
Product Description	Rabbit polyclonal antibody to GFP.
Clonality	Polyclonal
Immunogen	Recombinant full-length protein corresponding to Green Fluorescent Protein (GFP) from Aequorea victoria.
Manufacturer - Formulation	Supplied as an aliquot of serum with 0.05% Sodium Azide and 1.25% Sodium Chloride.
Recommended dilutions	WB: 1:1, 000-1:2, 500, ICC: 1:200-1:1, 000, Flow Cytometry: 1:100, IHC-P: 1:500-1:1, 000, IHC-Fr: 1:500-1:2, 000, Electron Microscopy: 1:1, 000-1:4, 000
Manufacturer - Specificity	This antibody is reactive against all variants of Aequorea victoria GFP such as S65T-GFP, RS-GFP, YFP, CFP, RFP, and EGFP.
Antigen species	Aequorea victoria

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ul

available

Delivery expected until 11/27/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer