Vergleich

DOG-1(DOG1.1), 0.2mg/mL

ArtNr B-BNUB0725-500
Hersteller Biotium
Menge 500 uL
Quantity options 100 uL 500 uL
Kategorie
Typ Antibody Monoclonal
Format Liquid
Applikationen IHC
Clon DOG1.1
Specific against Human (Homo sapiens)
Host Mouse
Isotype IgG1 Kappa
Konjugat/Tag BSA
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias Anoctamin 1,Calcium Activated Chloride Channel,Discovered On Gastrointestinal Stromal Tumors Protein 1,TAOS2,ORAOV2,TMEM16A
Versandbedingung Raumtemperatur
Lieferbar
Manufacturer - Type
Primary
Manufacturer - Applications
IHC, FFPE (verified)
Manufacturer - Category
Primary Antibodies Only
Manufacturer - Targets
DOG-1|TMEM16A
Manufacturer - Conjugate / Tag
Purified, with BSA
Manufacturer - Host
Mus musculus (mouse), BSA from bovine serum (Bos taurus) or recombinant BSA produced in Chinese hamster ovary cells.
Shipping Temperature
Room temperature
Storage Conditions
Store at 2 to 8°C|Protect fluorescent conjugates from light
2°C to 8°C
Molecular Weight
~114 kDa
Manufacturer - Research Area
Cancer
Description
Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GISTs), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GISTs, including all c-kit negative GISTs. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of DOG1 and c-kit in GISTs is nearly identical: 94.4% vs. 94.7%.Primary antibodies are available purified, or with a selection of fluorescent CF® Dyes and other labels. CF® Dyes offer exceptional brightness and photostability. Note: Conjugates of blue fluorescent dyes like CF®405S and CF®405M are not recommended for detecting low abundance targets, because blue dyes have lower fluorescence and can give higher non-specific background than other dye colors.
Product origin
Animal
Ingredient of biological origin
Mus musculus (mouse), BSA from bovine serum (Bos taurus) or recombinant BSA produced in Chinese hamster ovary cells.
Undated stability guarantee in PI
2 years
Stability at RT during shipping (protected from light)
Stable at room temperature or 37°C (98°F) for 7 days.
UNSPSC Commodity
41116161
UNSPSC Commodity Title
Primary and secondary antibodies for multiple methodology
immunostaining detection application
Classified or regulated chemicals
PBS, 0.05% BSA, 0.05% sodium azide (CAS 26628-22-8)
Concentration
0.2 mg/mL
Storage buffer
PBS, 0.05% BSA, 0.05% azide
Dated shelf life printed on label
Guaranteed for at least 24 months from date of receipt when stored as recommended
Immunogen (Secondaries, for anti tag only)
A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQL-LETCMEKERQKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a carrier protein.
Clonality
Monoclonal
Regulatory Status
For research use only (RUO)
Human Gene Symbol
TMEM16A
Unigene
503074
Positive Control
Gastrointestinal Stromal Tumor (GIST) or testicular germ cell tumor. Melanocytes in the basal layer of the epidermis and mast cells in the dermis of normal skin.
Antibody target cellular localization
Plasma membrane|Nucleus
Tumor expression
Gastrointestinal cancer
Antibody applications
IHC, FFPE (verified)
Verified antibody applications
IHC (FFPE) (verified)
Antibody application notes
Higher concentration may be required for direct detection using primary antibody conjugates than for indirect detection with secondary antibody|Immunofluorescence: 0.5-1 ug/mL|Immunohistology formalin-fixed 0.25-0.5 ug/mL|Staining of formalin-fixed tissues requires boiling tissue sections in 10 mM citrate buffer, pH 6.0, for 10-20 min followed by cooling at RT for 20 minutes|Flow Cytometry 0.5-1 ug/million cells/0.1 mL|Optimal dilution for a specific application should be determined by user
Manufacturer - Antibody Reactivity
DOG-1|TMEM16A
Antibody number
#0725

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 500 uL
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?